KEGG   Equus caballus (horse): 100033849
Entry
100033849         CDS       T01058                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04066  HIF-1 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04640  Hematopoietic cell lineage
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100033849 (EPO)
   04066 HIF-1 signaling pathway
    100033849 (EPO)
   04151 PI3K-Akt signaling pathway
    100033849 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100033849 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100033849 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033849 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100033849 (EPO)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  CSF and other factors
   100033849 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100033849
NCBI-ProteinID: NP_001075294
Ensembl: ENSECAG00000010733
VGNC: 51127
UniProt: Q867B1
LinkDB
Position
13
AA seq 192 aa
MGVRECPALLLLLSLLLPPLGLPALGAPPRLICDSRVLERYILEAREAENVTMGCAEGCS
FGENVTVPDTKVNFYSWKRMEVEQQAVEVWQGLALLSEAILQGQALLANSSQPSETLRLH
VDKAVSSLRSLTSLLRALGAQKEAISPPDAASAAPLRTFAVDTLCKLFRIYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgtcctgccctgctgcttctgctgtccctgctactgcctcctctg
ggcctcccagccctgggcgcccctccacgcctcatctgtgacagccgagtcctggagagg
tacatcctggaggccagggaggccgaaaatgtcacgatgggctgtgccgaaggctgcagc
tttggtgagaatgtcaccgttccagacaccaaggttaacttctactcctggaagaggatg
gaggtggagcagcaggctgtggaagtctggcagggcttggccctgctctcagaagccatt
ctgcagggccaggccctgttggccaactcctcccagccatctgagaccctgcggctgcat
gtggacaaagccgtcagcagcctgcgcagcctcacctccctgcttcgggcgctgggagcc
cagaaggaagccatctcccctccagatgcagcctctgctgctccactccgaacattcgct
gttgatactttgtgcaaactcttccgaatctactccaatttcctgcggggaaagctgaag
ctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system