KEGG   Equus caballus (horse): 100033855Help
Entry
100033855         CDS       T01058                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04146  Peroxisome
ecb04213  Longevity regulating pathway - multiple species
ecb05014  Amyotrophic lateral sclerosis (ALS)
ecb05016  Huntington disease
ecb05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100033855 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100033855 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100033855 (SOD1)
   05016 Huntington disease
    100033855 (SOD1)
   05020 Prion diseases
    100033855 (SOD1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100033855 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100033855
NCBI-ProteinID: NP_001075295
Ensembl: ENSECAG00000008958
VGNC: 23442
UniProt: P00443 D7PPM2
LinkDB All DBs
Position
26
AA seq 154 aa AA seqDB search
MALKAVCVLKGDGPVHGVIHFEQQQEGGPVVLKGFIEGLTKGDHGFHVHEFGDNTQGCTT
AGAHFNPLSKKHGGPKDEERHVGDLGNVTADENGKADVDMKDSVISLSGKHSIIGRTMVV
HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggccgtgtgcgtgctgaagggcgatggcccggtgcacggcgtcatccac
ttcgagcagcagcaggaaggtgggcccgtcgttctgaagggattcattgaaggattaacc
aaaggcgatcacggattccacgtccacgagtttggagataatacacaaggctgtaccact
gctggtgctcactttaatcctctgtcgaaaaaacacggtggaccaaaggacgaagagagg
catgttggagacctgggcaatgtgactgctgatgaaaatggtaaggctgatgtggatatg
aaagattctgtgatctcactctcgggaaagcattccatcattggccgcacaatggtggtc
cacgagaaacaagatgacctgggcaaaggtggaaatgaagaaagtacaaagacggggaac
gctggcagtcgtctggcttgtggtgtgattgggatcgctccgtaa

DBGET integrated database retrieval system