KEGG   Equus caballus (horse): 100033900
Entry
100033900         CDS       T01058                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 precursor
  KO
K13375  transforming growth factor beta-1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04218  Cellular senescence
ecb04350  TGF-beta signaling pathway
ecb04380  Osteoclast differentiation
ecb04390  Hippo signaling pathway
ecb04659  Th17 cell differentiation
ecb04672  Intestinal immune network for IgA production
ecb04926  Relaxin signaling pathway
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05144  Malaria
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05321  Inflammatory bowel disease
ecb05323  Rheumatoid arthritis
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100033900 (TGFB1)
   04350 TGF-beta signaling pathway
    100033900 (TGFB1)
   04390 Hippo signaling pathway
    100033900 (TGFB1)
   04068 FoxO signaling pathway
    100033900 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100033900 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100033900 (TGFB1)
   04218 Cellular senescence
    100033900 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100033900 (TGFB1)
   04672 Intestinal immune network for IgA production
    100033900 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100033900 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100033900 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033900 (TGFB1)
   05205 Proteoglycans in cancer
    100033900 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100033900 (TGFB1)
   05212 Pancreatic cancer
    100033900 (TGFB1)
   05225 Hepatocellular carcinoma
    100033900 (TGFB1)
   05226 Gastric cancer
    100033900 (TGFB1)
   05220 Chronic myeloid leukemia
    100033900 (TGFB1)
   05211 Renal cell carcinoma
    100033900 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100033900 (TGFB1)
   05321 Inflammatory bowel disease
    100033900 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100033900 (TGFB1)
   05414 Dilated cardiomyopathy
    100033900 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100033900 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033900 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100033900 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100033900 (TGFB1)
   05161 Hepatitis B
    100033900 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100033900 (TGFB1)
   05144 Malaria
    100033900 (TGFB1)
   05145 Toxoplasmosis
    100033900 (TGFB1)
   05140 Leishmaniasis
    100033900 (TGFB1)
   05142 Chagas disease
    100033900 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecb03110]
    100033900 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100033900 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100033900 (TGFB1)
Chaperones and folding catalysts [BR:ecb03110]
 Intramolecular chaperones
  Others
   100033900 (TGFB1)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100033900 (TGFB1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100033900 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100033900
NCBI-ProteinID: NP_001075318
Ensembl: ENSECAG00000011671
VGNC: 24051
UniProt: O19011
LinkDB
Position
10
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRAQVAGESAETEPEPEADYYAKEVTRVLMVEKENEI
YKTVETGSHSIYMFFNASELRAAVPDPMLLSRAELRLLRLKLSVEQHVELYQKYSNNSWR
YLSNRLLTPSDSPEWLSFDVTGVVRQWLSQGGAMEGLRLSAHCPCDSKDNTLRVGINGFS
SSRRGDLATIDGMNRPFLLLMATPLERAQQLHSSRHRRALDTNYCSSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQV
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccggcctgcggctgctgccgctgctgctgccactgctgtggctactagtg
ctgacgcctggccggccagccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagttgcggctcgcc
agccccccgagccagggggaggttccgcccggcccgctgcccgaggccgtgctggccctt
tacaacagtacccgcgcccaggtggccggagagagcgctgagacggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaaggaaaacgaaatc
tataagactgtggagaccggctcacacagcatatatatgttcttcaatgcgtcggagctc
cgggcagcagtgcccgatcccatgctgctctcccgggcagagctgcgcctcctaaggctc
aagttaagcgtggagcagcatgtggagctgtaccagaaatacagcaataattcctggcgc
tacctcagtaaccggctgctgacccccagcgactcgccggaatggctgtcctttgatgtc
accggagtcgtgcggcagtggctgagccagggaggggcaatggagggccttcgcctcagt
gcccactgcccctgtgacagcaaagataacacactccgcgtgggcatcaacgggttcagt
tccagccgccggggtgatctggccaccattgatggcatgaaccggcccttcctgctcctc
atggccaccccactggagagggcccagcagctgcacagctcccggcaccgccgagctctg
gacaccaactactgttccagctccacagagaagaactgctgcgtacggcagctgtacatt
gactttcgcaaggatctgggctggaagtggatccacgagcccaagggctaccacgccaac
ttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcaggtg
ctggagccgctgcccatcgtgtactacgtgggtcgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Equus caballus (horse): 100050377
Entry
100050377         CDS       T01058                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X2
  KO
K13376  transforming growth factor beta-2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04218  Cellular senescence
ecb04350  TGF-beta signaling pathway
ecb04380  Osteoclast differentiation
ecb04390  Hippo signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05144  Malaria
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05321  Inflammatory bowel disease
ecb05323  Rheumatoid arthritis
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100050377 (TGFB2)
   04350 TGF-beta signaling pathway
    100050377 (TGFB2)
   04390 Hippo signaling pathway
    100050377 (TGFB2)
   04068 FoxO signaling pathway
    100050377 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100050377 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100050377 (TGFB2)
   04218 Cellular senescence
    100050377 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100050377 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050377 (TGFB2)
   05206 MicroRNAs in cancer
    100050377 (TGFB2)
   05205 Proteoglycans in cancer
    100050377 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100050377 (TGFB2)
   05212 Pancreatic cancer
    100050377 (TGFB2)
   05225 Hepatocellular carcinoma
    100050377 (TGFB2)
   05226 Gastric cancer
    100050377 (TGFB2)
   05220 Chronic myeloid leukemia
    100050377 (TGFB2)
   05211 Renal cell carcinoma
    100050377 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100050377 (TGFB2)
   05321 Inflammatory bowel disease
    100050377 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100050377 (TGFB2)
   05414 Dilated cardiomyopathy
    100050377 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100050377 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100050377 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100050377 (TGFB2)
   05161 Hepatitis B
    100050377 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100050377 (TGFB2)
   05144 Malaria
    100050377 (TGFB2)
   05145 Toxoplasmosis
    100050377 (TGFB2)
   05140 Leishmaniasis
    100050377 (TGFB2)
   05142 Chagas disease
    100050377 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100050377 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100050377 (TGFB2)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100050377 (TGFB2)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100050377 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100050377
NCBI-ProteinID: XP_001489401
Ensembl: ENSECAG00000016688
VGNC: 24053
UniProt: F6YX31
LinkDB
Position
30
AA seq 414 aa
MHYCVLSAFLLLHLVAVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgctcctgcatttggtcgcggtggcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcccgaaccg
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgcct
actttctacagaccctacttcagaattgtccgatttgacgtctcagcgatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttacagaaccccaaagccaga
gtgcccgaacaacggattgaattgtatcagattctcaaatccaaagatttaacatctcca
acccagcgttacatcgacagcaaagtggtgaaaacaagagcagaaggcgaatggctctcc
tttgacgtcactgacgctgttcatgaatggctccaccataaagacaggaacctgggattt
aaaataagtttacactgtccttgctgcacctttgtaccgtctaataattacatcatcccc
aacaaaagcgaagaactagaagcaagattcgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagacttgagtcacaacagtccaaccggcggaag
aagcgtgctctggacgcagcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatcttgggtggaaatggatacatgaacctaaaggg
tacaatgccaacttctgtgctggagcatgcccatatttatggagttcagacactcagcac
agtagggttctcagcttatataataccataaacccagaagcatctgcttctccttgctgt
gtgtcgcaggatttagaaccgctgaccattctctactacataggcaaaacacccaagatc
gaacagctttctaatatgatcgtcaagtcttgcaaatgcagctaa

KEGG   Equus caballus (horse): 100051765
Entry
100051765         CDS       T01058                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04218  Cellular senescence
ecb04350  TGF-beta signaling pathway
ecb04390  Hippo signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05144  Malaria
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05321  Inflammatory bowel disease
ecb05323  Rheumatoid arthritis
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100051765 (TGFB3)
   04350 TGF-beta signaling pathway
    100051765 (TGFB3)
   04390 Hippo signaling pathway
    100051765 (TGFB3)
   04068 FoxO signaling pathway
    100051765 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100051765 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100051765 (TGFB3)
   04218 Cellular senescence
    100051765 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051765 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051765 (TGFB3)
   05212 Pancreatic cancer
    100051765 (TGFB3)
   05225 Hepatocellular carcinoma
    100051765 (TGFB3)
   05226 Gastric cancer
    100051765 (TGFB3)
   05220 Chronic myeloid leukemia
    100051765 (TGFB3)
   05211 Renal cell carcinoma
    100051765 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100051765 (TGFB3)
   05321 Inflammatory bowel disease
    100051765 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100051765 (TGFB3)
   05414 Dilated cardiomyopathy
    100051765 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051765 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100051765 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051765 (TGFB3)
   05161 Hepatitis B
    100051765 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100051765 (TGFB3)
   05144 Malaria
    100051765 (TGFB3)
   05145 Toxoplasmosis
    100051765 (TGFB3)
   05140 Leishmaniasis
    100051765 (TGFB3)
   05142 Chagas disease
    100051765 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100051765 (TGFB3)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100051765 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100051765
NCBI-ProteinID: XP_001492737
Ensembl: ENSECAG00000015029
VGNC: 24054
LinkDB
Position
24
AA seq 412 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMHGEREDGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccttgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgagccatcg
gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcacggggagagggaggacggctgcactcaggaaaacacggagtcggagtac
tatgccaaagaaatccataagttcgacatgatccagggcctggcggagcacaatgagctg
gccgtctgccccaaaggaatcacctccaaggttttccgcttcaacgtgtcctcagtggag
aaaaatggaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tccaagcgcaacgagcagaggatcgagctcttccagatactccggccggatgagcatatc
gccaaacaacgctatatcggtggcaagaacctgcccacgcggggcaccgctgagtggctg
tcttttgatgtcactgacactgtgcgtgaatggctcttgcgaagagagtccaacttaggt
ctggaaatcagcatccattgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggtgtggacagtgaagatgatcatggc
cgtggagacttggggcgcctcaagaagcagaaggaccaccacaaccctcatctaatcctc
atgatgattcccccacatcggctggacaacccgggccaggggggtcagaggaagaagcgg
gccctggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccctctc
tacattgactttcgacaggatctgggctggaaatgggtccatgagcctaagggctactat
gccaacttctgctcaggcccttgcccgtacctccgcagtgcggacacaacccacagcacg
gtgctgggactgtacaacaccctgaatcccgaagcatctgcctcaccttgctgtgtgccc
caggacttggagcccctgaccatcctgtactatgtcgggaggacccccaaggtggaacag
ctctctaacatggtggtgaagtcctgtaagtgtagctga

KEGG   Equus caballus (horse): 111771316
Entry
111771316         CDS       T01058                                 

Definition
(RefSeq) transforming growth factor beta-2-like isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04218  Cellular senescence
ecb04350  TGF-beta signaling pathway
ecb04380  Osteoclast differentiation
ecb04390  Hippo signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05144  Malaria
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05321  Inflammatory bowel disease
ecb05323  Rheumatoid arthritis
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111771316
   04350 TGF-beta signaling pathway
    111771316
   04390 Hippo signaling pathway
    111771316
   04068 FoxO signaling pathway
    111771316
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111771316
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111771316
   04218 Cellular senescence
    111771316
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111771316
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111771316
   05206 MicroRNAs in cancer
    111771316
   05205 Proteoglycans in cancer
    111771316
  09162 Cancer: specific types
   05210 Colorectal cancer
    111771316
   05212 Pancreatic cancer
    111771316
   05225 Hepatocellular carcinoma
    111771316
   05226 Gastric cancer
    111771316
   05220 Chronic myeloid leukemia
    111771316
   05211 Renal cell carcinoma
    111771316
  09163 Immune disease
   05323 Rheumatoid arthritis
    111771316
   05321 Inflammatory bowel disease
    111771316
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111771316
   05414 Dilated cardiomyopathy
    111771316
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111771316
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111771316
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111771316
   05161 Hepatitis B
    111771316
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111771316
   05144 Malaria
    111771316
   05145 Toxoplasmosis
    111771316
   05140 Leishmaniasis
    111771316
   05142 Chagas disease
    111771316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    111771316
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    111771316
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111771316
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111771316
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 111771316
NCBI-ProteinID: XP_023488373
LinkDB
Position
30
AA seq 416 aa
MHYCVLSAFLLLHLVAVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVNIWLTCLFYSWVANVYLLIVFLNEF
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgctcctgcatttggtcgcggtggcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcccgaaccg
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccttctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcctactttctacagaccctacttcagaattgtccgattt
gacgtctcagcgatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttacagaaccccaaagccagagtgcccgaacaacggattgaattgtatcagattctc
aaatccaaagatttaacatctccaacccagcgttacatcgacagcaaagtggtgaaaaca
agagcagaaggcgaatggctctcctttgacgtcactgacgctgttcatgaatggctccac
cataaagacaggaacctgggatttaaaataagtttacactgtccttgctgcacctttgta
ccgtctaataattacatcatccccaacaaaagcgaagaactagaagcaagattcgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctctggacgcagcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgaacctaaagggtacaatgccaacttctgtgctggagcatgcccatat
ttatggagttcagacactcagcacagtagggtaaatatttggctaacttgtctcttctat
tcttgggttgctaatgtgtacctgctgatagtatttctaaatgaattctaa

DBGET integrated database retrieval system