KEGG   Equus caballus (horse): 100033918
Entry
100033918         CDS       T01058                                 

Gene name
MITF
Definition
(RefSeq) microphthalmia-associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04137  Mitophagy - animal
ecb04380  Osteoclast differentiation
ecb04916  Melanogenesis
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05218  Melanoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100033918 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100033918 (MITF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100033918 (MITF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033918 (MITF)
   05202 Transcriptional misregulation in cancer
    100033918 (MITF)
  09162 Cancer: specific types
   05218 Melanoma
    100033918 (MITF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100033918 (MITF)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    100033918 (MITF)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726 Ribophorin_I
Other DBs
NCBI-GeneID: 100033918
NCBI-ProteinID: NP_001157346
Ensembl: ENSECAG00000005360
VGNC: 20201
UniProt: A0A3Q2I515
LinkDB
Position
16
AA seq 519 aa
MGHVENTSVVFPRAIFSTWEKETMELTLCLSLRSSSEEHPGASKPPISSSSMTSRILLRQ
QLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQT
HLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSP
MAMLTLNSNCEKEGFYKFEEQNRAESECPSMNTHSRASCMQMDDVIDDIISLESSYNEEI
LGLMDPALQMANTLPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTESEARALA
KERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQRE
QQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPA
LENCNQDLLQHHADLTCTTTLDLTDGTISFNNNLGTGTESNQAYSIPAKMGSKLEDILMD
DTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHAC
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgggacacgttgaaaatacttcggtggtgttcccacgagctattttctctacctgggaa
aaggagaccatggaattgactctgtgcctgtctttgagaagcagttccgaggagcatcct
ggggcctccaagcctccgataagctcctcaagtatgacatcacgcatcttgctacgccag
caactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctgcag
gcggcccagttcatgcaacagagagtgcccgtgagtcagacaccagccataaacgtcagc
gtgcccaccacccttccgtctgccacccaggtgccgatggaagtccttaaggtgcagacc
cacctcgaaaaccccaccaagtaccacatacagcaagcccaaaggcagcaggtaaagcag
tacctttctaccactttagcaaataaacatgccaaccaagtcctgagcttgccatgtcca
aaccagcctggcgatcatgtcatgccaccggtgccggggagcagcgcacccaacagcccc
atggctatgcttacacttaactccaactgtgaaaaagaggggttttataaatttgaagag
caaaacagggcggagagcgaatgcccaagtatgaacacacattcgcgagcatcgtgcatg
cagatggatgatgtgatcgatgacatcattagcctagaatcaagttataatgaagaaatc
ctgggcttgatggatcctgccttgcaaatggcaaatacgttacctgtctccggaaactta
attgacctttacagcaaccaaggcctgccgcccccaggcctcaccatcagcaactcgtgt
ccagccaacctccccaacataaaaagggagctcacagagtcggaagcaagagcattggct
aaagagaggcagaaaaaggacaatcacaacttgattgaacgaagaagaagatttaacata
aatgaccgcattaaagaactaggtactttgattcccaagtcaaatgatccagacatgcgc
tggaacaagggaaccattttaaaagcatctgtggactatatccgaaaattgcaacgagaa
cagcaacgtgcaaaagaacttgaaaaccgacagaagaaactggagcatgccaaccggcat
ttgttgctcagaatacaggaacttgaaatgcaggctcgcgctcatggactttcccttatt
ccatccacgggtctctgctctccagatttagtgaatcggatcatcaagcaagaacccgcc
cttgagaactgcaaccaagacctccttcagcatcacgcagacctaacttgtacaaccacc
ctggatctcacagacggcaccatcagcttcaacaacaacctcggaaccgggaccgagagc
aaccaagcctacagcatccccgcgaaaatgggatccaaactggaagacatcctgatggat
gatactctttctccggttggtgtaactgatccactgctttcctcagtgtcccccggagct
tccaaaacgagcagccgaaggagcagtatgagcatggaagaaaccgagcatgcttgttag

DBGET integrated database retrieval system