KEGG   Equus caballus (horse): 100033947Help
Entry
100033947         CDS       T01058                                 

Gene name
TIMP3
Definition
(RefSeq) metalloproteinase inhibitor 3 precursor
  KO
K16866  metalloproteinase inhibitor 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100033947 (TIMP3)
   05205 Proteoglycans in cancer
    100033947 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100033947 (TIMP3)
Peptidases and inhibitors [BR:ecb01002]
 Peptidase inhibitors
  Family I35: timp family
   100033947 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 100033947
NCBI-ProteinID: NP_001075339
Ensembl: ENSECAG00000018314
VGNC: 24109
UniProt: Q9TUL9
LinkDB All DBs
Position
28
AA seq 211 aa AA seqDB search
MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCYVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactccctggcttgggctcgtcgtgctcctgggcagctggagcctgggggactggggc
gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactctgacatc
gtgatccgggccaaggtggtggggaagaagctggtgaaggaggggccctttggcacactg
gtctacaccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccatgtgcag
tacatccacacggaagcttccgaaagtctctgtggccttaagctggaggtcaacaagtac
cagtacctgctgacaggccgtgtctacgacggaaagatgtacacaggactctgcaacttc
gtggagaggtgggaccagctcaccctctcccagcgcaaggggctgaactatcggtatcac
ctgggttgtaactgcaagatcaaatcctgctactacctgccttgctacgtgacctccaag
aacgagtgtctctggaccgacatgctctccaatttcggctaccctggctaccagtccaaa
cactacgcctgcatccggcagaagggtggctactgcagctggtaccgaggctgggccccc
ccggacaagagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system