KEGG   Equus caballus (horse): 100033955
Entry
100033955         CDS       T01058                                 

Gene name
FGF2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04810  Regulation of actin cytoskeleton
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100033955 (FGF2)
   04014 Ras signaling pathway
    100033955 (FGF2)
   04015 Rap1 signaling pathway
    100033955 (FGF2)
   04020 Calcium signaling pathway
    100033955 (FGF2)
   04151 PI3K-Akt signaling pathway
    100033955 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100033955 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100033955 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033955 (FGF2)
   05205 Proteoglycans in cancer
    100033955 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100033955 (FGF2)
   05218 Melanoma
    100033955 (FGF2)
   05224 Breast cancer
    100033955 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100033955 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100033955 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100033955 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100033955 (FGF2)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100033955 (FGF2)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100033955 (FGF2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 100033955
NCBI-ProteinID: NP_001182150
UniProt: E0AEV7
LinkDB
Position
2
AA seq 155 aa
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI
KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY
SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcagccgggagcatcaccacgctgcccgccctgcccgaggacggcggcagcggcgcc
ttcccgcccggccacttcaaggaccccaagcggctctactgcaaaaacgggggcttcttc
ctgcgcatccaccccgacggccgagtggacggggtccgggagaagagcgaccctcacatc
aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac
cgttatcttgctatgaaggaagatggaaggttactggcttctaaatgtgttacggacgag
tgtttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac
tccagttggtatgtggccctgaaacgaacggggcagtataaacttggacccaaaacagga
cctggacagaaagctatactttttcttccaatgtctgctaagagctga

KEGG   Equus caballus (horse): 100033960
Entry
100033960         CDS       T01058                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04390  Hippo signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100033960 (FGF1)
   04014 Ras signaling pathway
    100033960 (FGF1)
   04015 Rap1 signaling pathway
    100033960 (FGF1)
   04390 Hippo signaling pathway
    100033960 (FGF1)
   04020 Calcium signaling pathway
    100033960 (FGF1)
   04151 PI3K-Akt signaling pathway
    100033960 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100033960 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033960 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100033960 (FGF1)
   05218 Melanoma
    100033960 (FGF1)
   05224 Breast cancer
    100033960 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100033960 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100033960 (FGF1)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100033960 (FGF1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100033960 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100033960
NCBI-ProteinID: NP_001157358
Ensembl: ENSECAG00000020769
VGNC: 18008
UniProt: F6WDN0
LinkDB
Position
14
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaatcacaaccttcacggccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaatgggggccacttcctgaggatc
cttccagatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggctgttgtacggctcacagacaccaaacgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcatgcagagaag
aactggttcgttggtctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
gggcagaaagcaatcttgtttcttcccctgcccgtctcctctgactaa

KEGG   Equus caballus (horse): 100033961
Entry
100033961         CDS       T01058                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100033961 (FGF7)
   04014 Ras signaling pathway
    100033961 (FGF7)
   04015 Rap1 signaling pathway
    100033961 (FGF7)
   04020 Calcium signaling pathway
    100033961 (FGF7)
   04151 PI3K-Akt signaling pathway
    100033961 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100033961 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033961 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    100033961 (FGF7)
   05218 Melanoma
    100033961 (FGF7)
   05224 Breast cancer
    100033961 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100033961 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100033961 (FGF7)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100033961 (FGF7)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100033961 (FGF7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100033961
NCBI-ProteinID: NP_001157355
Ensembl: ENSECAG00000015510
VGNC: 18020
UniProt: F6TLF7
LinkDB
Position
1
AA seq 194 aa
MRKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNFNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtttagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccccgagcgacatacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactattctgtcgaacacagtggtatctgaggattgat
aaacgaggcaaagtcaaagggactcaagagatgaagaacaatttcaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtagaaagtgaatactatcttgca
atgaacaaagaaggaaaactctatgcaaagaaagaatgcaacgaagattgcaacttcaaa
gaattaattctggaaaaccattacaacacatatgcttcagctaaatggacacacagtgga
ggagaaatgtttgttgccttaaatcaaaagggggttcctgttagagggaaaaaaacaaag
aaagaacagaaaacagcccactttcttcctatggcaataacttaa

KEGG   Equus caballus (horse): 100034198
Entry
100034198         CDS       T01058                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I precursor
  KO
K05459  insulin-like growth factor 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04114  Oocyte meiosis
ecb04115  p53 signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05205  Proteoglycans in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100034198 (IGF1)
   04014 Ras signaling pathway
    100034198 (IGF1)
   04015 Rap1 signaling pathway
    100034198 (IGF1)
   04066 HIF-1 signaling pathway
    100034198 (IGF1)
   04068 FoxO signaling pathway
    100034198 (IGF1)
   04151 PI3K-Akt signaling pathway
    100034198 (IGF1)
   04152 AMPK signaling pathway
    100034198 (IGF1)
   04150 mTOR signaling pathway
    100034198 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100034198 (IGF1)
   04115 p53 signaling pathway
    100034198 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100034198 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100034198 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100034198 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100034198 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100034198 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100034198 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100034198 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100034198 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100034198 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100034198 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100034198 (IGF1)
   05202 Transcriptional misregulation in cancer
    100034198 (IGF1)
   05205 Proteoglycans in cancer
    100034198 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100034198 (IGF1)
   05218 Melanoma
    100034198 (IGF1)
   05215 Prostate cancer
    100034198 (IGF1)
   05224 Breast cancer
    100034198 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100034198 (IGF1)
   05414 Dilated cardiomyopathy
    100034198 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100034198 (IGF1)
   01522 Endocrine resistance
    100034198 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100034198 (IGF1)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100034198 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100034198
NCBI-ProteinID: NP_001075967
Ensembl: ENSECAG00000010109
VGNC: 18967
UniProt: A7LHD8
LinkDB
Position
28
AA seq 153 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtcctcctcacatctcttctacctggccctgtgcttgctc
accttcaccagctctgccacggctggaccggagacactctgcggggctgagctggtggac
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtacggc
tccagcagtcggagggcgcctcagacaggcatcgtggacgagtgctgcttccggagctgt
gatctgaggaggctggagatgtactgcgcacccctcaagcctgccaagtcggcccgctcc
gtccgtgcccagcgccacaccgatatgcccaaggctcagaaggaagtacatttgaagaac
gcaagtagagggagtgcgggaaacaagaactacagaatgtag

KEGG   Equus caballus (horse): 100049848
Entry
100049848         CDS       T01058                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb05144  Malaria
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05218  Melanoma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049848 (HGF)
   04014 Ras signaling pathway
    100049848 (HGF)
   04015 Rap1 signaling pathway
    100049848 (HGF)
   04020 Calcium signaling pathway
    100049848 (HGF)
   04151 PI3K-Akt signaling pathway
    100049848 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100049848 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100049848 (HGF)
   05205 Proteoglycans in cancer
    100049848 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100049848 (HGF)
   05226 Gastric cancer
    100049848 (HGF)
   05218 Melanoma
    100049848 (HGF)
   05211 Renal cell carcinoma
    100049848 (HGF)
   05223 Non-small cell lung cancer
    100049848 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    100049848 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100049848 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100049848 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100049848 (HGF)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100049848 (HGF)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100049848 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 100049848
NCBI-ProteinID: XP_014594625
Ensembl: ENSECAG00000011223
VGNC: 18769
LinkDB
Position
4
AA seq 745 aa
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNSADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVRKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKVCAHSTMNDTDIPM
ETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTADPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRQNEHLVMFRVCCFCRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGHPLIPWDYCP
ISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIK
ESWILTARQCFPARNKDLKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLK
LTRPAVLDDFVSTIDLPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCS
QYHQGKVTLNESEICAGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRP
GIFVRVAYYAKWIHKIILTYKVPQL
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagtcctgctgctgcagcatgtccttctgcatctcctt
ctgcttcccatcgccataccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaag
acaaaaaaaatgaacagtgcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaagcaagaaaacgatgcctctggttccct
ttcaatagtatgtcaagtggagtgagaaaagagtttggccatgaattcgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctacaagggaacggtg
tctatcactaagagtggcatcaaatgccagccctggaattccatgataccacatgagcac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaaccct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcgt
ggtcccatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgccagaaagatatcctgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtactgtgcaattaaagtgtgcgctcacagtactatgaatgacacagatatccctatg
gaaacaactgaatgcattcaaggtcaaggagaaggttaccggggcaccatcaataccatt
tggaatggaattccatgtcagcgttgggattcccagtatcctcatcagcatgatataact
cctgaaaatttcaaatgcaaggatctaagagaaaattattgccgaaatccagatggggct
gagtcaccctggtgttttaccgctgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgacgtgtcaagtggacaagactgttatcgtgggaatggcaaaaattacatg
ggcaatttatccaaaacacgatcgggactaacatgttcaatgtgggacaagaacatggag
gacttacacagacaaaatgagcatcttgtgatgttcagagtttgttgcttctgcaggcac
atcttctgggaaccagacgctagtaagctgaataagaattactgccggaatcctgatgat
gatgctcatggtccctggtgttacacagggcatcctctcattccttgggattattgccct
atttctcgttgtgaaggtgataccacacctacaatagtcaatttagaccatcctgtaata
tcttgcgccaaaacaaaacaattgcgagttgtaaatggaattccaacacgaacaaatgtg
ggatggatggttagtttgaaatacagaaataaacatatctgcggaggatcattgataaag
gaaagttggattcttactgcaagacaatgtttccctgctcgaaacaaagacttgaaagat
tatgaagcttggcttgggattcatgatgtccatggaagaggagatgagaaacgcaaacag
gttctaaatgtttcccagctggtatatgggcctgaaggatcagatctggtattactgaag
cttactaggcctgctgtcttggatgattttgttagtacaattgatttacctaattatgga
tgcacgattcctgaaaaaaccacttgcagtgtttatggctggggctacactggattgatc
aactctgatggtctgttacgagtagcacatctctatattatggggaatgagaagtgcagc
caatatcatcaagggaaggtgactttgaatgagtctgaaatatgtgctggggctgaaaat
attgtatcaggaccatgcgagggggattatggtggcccacttgtttgtgaacaacataaa
atgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattccaaatcgtcct
ggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatattaacatat
aaggtaccacagttgtag

KEGG   Equus caballus (horse): 100050037
Entry
100050037         CDS       T01058                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100050037 (FGF20)
   04014 Ras signaling pathway
    100050037 (FGF20)
   04015 Rap1 signaling pathway
    100050037 (FGF20)
   04020 Calcium signaling pathway
    100050037 (FGF20)
   04151 PI3K-Akt signaling pathway
    100050037 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100050037 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050037 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    100050037 (FGF20)
   05218 Melanoma
    100050037 (FGF20)
   05224 Breast cancer
    100050037 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100050037 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100050037 (FGF20)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100050037 (FGF20)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100050037 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100050037
NCBI-ProteinID: XP_001488279
Ensembl: ENSECAG00000012457
VGNC: 18015
LinkDB
Position
27
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAERGARGGPGAAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHADTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDILMYS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaagtcgggggcttcctgggcggcctggagggcttgggccagcag
gtgggctcgcacttcctgctgcctcctgccggggagcggccgccgctgctgggcgagcgc
cggggcgcggcggagcggggcgcgcgtggagggcccggggctgcggagctggcgcacctg
cacggcatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
cccgacggcagcgtgcagggcacccggcaggaccacagcctctttggtatcctggagttc
atcagtgtggcagtgggactcgtcagtattagaggtgtggacagcggtctttatctggga
atgaatgacaaaggagaactctatggatcagagaaactgacttctgaatgcatctttagg
gagcaatttgaagagaattggtataatacctattcatccaacatatataaacatgcggac
actggccgcaggtattttgtggcactcaacaaagatggaactccaagagatggtgccagg
tccaaaagacatcagaaatttacacatttcttgcctagaccagtggatccagaaagagtt
cctgaattgtacaaggacatactgatgtacagttga

KEGG   Equus caballus (horse): 100050353
Entry
100050353         CDS       T01058                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100050353 (FGF9)
   04014 Ras signaling pathway
    100050353 (FGF9)
   04015 Rap1 signaling pathway
    100050353 (FGF9)
   04020 Calcium signaling pathway
    100050353 (FGF9)
   04151 PI3K-Akt signaling pathway
    100050353 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100050353 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050353 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    100050353 (FGF9)
   05218 Melanoma
    100050353 (FGF9)
   05224 Breast cancer
    100050353 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100050353 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100050353 (FGF9)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100050353 (FGF9)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100050353 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100050353
NCBI-ProteinID: XP_005601151
Ensembl: ENSECAG00000018716
VGNC: 18021
UniProt: F7B6A2
LinkDB
Position
17
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggcttcccaggggacccgcggtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaacggt
actatccagggaaccaggaaagaccacagccgattcggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagcggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt
gaagaaaactggtataacacgtactcttcgaatctatataaacatgtggacactggaagg
cgatactatgttgcgttaaataaagatgggaccccaagagaaggaacgaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacccgaacta
tataaggatattctaagccaaagttga

KEGG   Equus caballus (horse): 100051221
Entry
100051221         CDS       T01058                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100051221 (FGF6)
   04014 Ras signaling pathway
    100051221 (FGF6)
   04015 Rap1 signaling pathway
    100051221 (FGF6)
   04020 Calcium signaling pathway
    100051221 (FGF6)
   04151 PI3K-Akt signaling pathway
    100051221 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100051221 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051221 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    100051221 (FGF6)
   05218 Melanoma
    100051221 (FGF6)
   05224 Breast cancer
    100051221 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100051221 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100051221 (FGF6)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100051221 (FGF6)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100051221 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100051221
NCBI-ProteinID: XP_001494385
Ensembl: ENSECAG00000022017
VGNC: 18019
UniProt: F6YKX9
LinkDB
Position
6
AA seq 208 aa
MALGQRLFITMSRGAGRLQGTLRALVFLGVLVGMVVPSPAGTRANSTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFIAMNSKGRLYTTPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtcttcagggc
acgctgcgggctctcgtcttcctaggcgtcctagtgggcatggtggtgccctcgcctgca
ggcacccgcgccaacagcacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgctgggctagctggagagattgctggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ccccccgatggccggatcagcgggacccacgaggagaacccctacagcctgctggagatt
tccacagtggagcgaggcgtggtgagcctctttggagtgaaaagtgccctcttcatcgcc
atgaacagtaaagggagactatacacaacgcccagcttccaggaggaatgcaagttcaga
gaaaccctcctgcccaataattacaacgcctacgagtcagacctgtaccgagggacttac
atcgcactgagcaaatatggacgggtaaagcggggcagcaaggtgtccccaatcatgacc
gtcactcacttccttcccaggatataa

KEGG   Equus caballus (horse): 100052655
Entry
100052655         CDS       T01058                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100052655 (FGF10)
   04014 Ras signaling pathway
    100052655 (FGF10)
   04015 Rap1 signaling pathway
    100052655 (FGF10)
   04020 Calcium signaling pathway
    100052655 (FGF10)
   04151 PI3K-Akt signaling pathway
    100052655 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100052655 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100052655 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    100052655 (FGF10)
   05218 Melanoma
    100052655 (FGF10)
   05224 Breast cancer
    100052655 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100052655 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100052655 (FGF10)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100052655 (FGF10)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100052655 (FGF10)
SSDB
Motif
Pfam: FGF SR-25 Fascin IMUP
Other DBs
NCBI-GeneID: 100052655
NCBI-ProteinID: XP_001498159
Ensembl: ENSECAG00000014361
VGNC: 18009
UniProt: F7CND4
LinkDB
Position
21
AA seq 216 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSVSVTCQALGQDMVSPEATNSSSSSSSSSS
SSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILE
ITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHN
GRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcccggctgctgc
tgctgcttcttgttgctgttcttggtgtcttccgtctctgtcacctgccaagcccttggt
caggacatggtgtcaccagaggccaccaactcctcttcttcttcttcctcctcctcctcg
tcctcctcctccttctcctctccttccagcgcggggaggcatgtgcggagctacaatcac
ctccaaggagatgtccgctggagaaagcttttctctttcaccaaatactttctcaagatt
gagaagaacggcaaggtcagcggtaccaagaaggagaactgcccgtacagtatcctggaa
ataacttcagtggaaataggagttgttgccgtcaaagccattaacagcaactattattta
gccatgaacaagaagggcaaactctatggctcaaaagaatttaacaatgactgtaagctg
aaggaaaggatagaggaaaacggatacaatacctatgcatcctttaactggcagcacaac
gggaggcaaatgtatgtggcattgaatggaaaaggagctcccaggagaggacagaaaaca
cgaaggaaaaacacctcagctcattttcttccaatggtggtccactcgtag

KEGG   Equus caballus (horse): 100054542
Entry
100054542         CDS       T01058                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04714  Thermogenesis
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100054542 (FGF21)
   04014 Ras signaling pathway
    100054542 (FGF21)
   04015 Rap1 signaling pathway
    100054542 (FGF21)
   04020 Calcium signaling pathway
    100054542 (FGF21)
   04151 PI3K-Akt signaling pathway
    100054542 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100054542 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100054542 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054542 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    100054542 (FGF21)
   05218 Melanoma
    100054542 (FGF21)
   05224 Breast cancer
    100054542 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100054542 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100054542 (FGF21)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100054542 (FGF21)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100054542 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100054542
NCBI-ProteinID: XP_001489202
Ensembl: ENSECAG00000010695
VGNC: 18016
LinkDB
Position
10
AA seq 209 aa
MDWDKTGFKYQGLWVPVLAVLLLGACQSHPIPDSSPLLQFGGQVRQRHLYTDDAQETEAH
LEIRADGTVAGAVHRSPESLLELKALKPGVIQILGVKTSRFLCQGPDGTLYGSLHFDPVA
CSFRELLLEDGYNVYQSETLGLPLRLPHHSSPYRDPAPRAPARFLPLPGFPPAPPEPPGI
PAPEPPDVGSSDPLSMVGPSRGRSPSYTS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggactgggacaagacggggttcaagtaccagggactgtgggtccctgtgctggctgtc
cttctgctgggagcctgccagtcacaccccatccctgactccagtcccctcctccaattc
gggggccaagtcaggcagcgccacctctacacagatgatgcccaggagacagaggcgcac
ctggagatcagggctgacggcactgtggcaggggctgtccaccggagcccagaaagtctc
ttggagctgaaagccctgaagccaggggtaattcaaatcttgggagtcaagacatccagg
tttctgtgccaggggccagacgggacgctgtacggatcgctccacttcgaccccgtggcc
tgcagcttccgggagctgcttctcgaagacggctacaacgtttaccagtctgagaccctt
ggcctcccactccgcctgccccaccacagctccccataccgggatccggcccctcgggca
cccgcccgcttcctgccgctgccaggctttcccccagcacccccggagcctccagggatc
ccggcccccgagcctccggacgtgggctcctcggaccccctgagcatggtggggccttca
cgcggccggagccccagctacacttcctga

KEGG   Equus caballus (horse): 100055086
Entry
100055086         CDS       T01058                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05231  Choline metabolism in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100055086 (PDGFA)
   04014 Ras signaling pathway
    100055086 (PDGFA)
   04015 Rap1 signaling pathway
    100055086 (PDGFA)
   04630 JAK-STAT signaling pathway
    100055086 (PDGFA)
   04020 Calcium signaling pathway
    100055086 (PDGFA)
   04072 Phospholipase D signaling pathway
    100055086 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100055086 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100055086 (PDGFA)
   04540 Gap junction
    100055086 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100055086 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055086 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100055086 (PDGFA)
   05206 MicroRNAs in cancer
    100055086 (PDGFA)
   05231 Choline metabolism in cancer
    100055086 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100055086 (PDGFA)
   05218 Melanoma
    100055086 (PDGFA)
   05215 Prostate cancer
    100055086 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100055086 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100055086 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100055086 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100055086 (PDGFA)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100055086 (PDGFA)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100055086 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 100055086
NCBI-ProteinID: XP_023510822
LinkDB
Position
13
AA seq 207 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGPEDALD
TSLRAHGGHATKHAAEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSIKCQPTRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACT
AAGPREEETGRRRESGKKRKRKRLKPT
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaggacctgggcatgcctcctgcttctcggctgcggatatctcgcccatgccctcgcc
gaggaagccgagatcccccgcgagctgattgagaggctggcgcgcagtcagatccacagc
atccgggacctccagcgactcctggagatagactccgtagggcccgaggatgccctggac
accagcctgagagcccacgggggccacgccaccaagcatgcggccgagaagcggcctgtg
cccatccggaggaaaaggagcatcgaggaggccatccccgctgtctgtaagacccgcacg
gtcatttacgagatacctcggagccaggtggaccccacgtccgccaacttcctgatctgg
ccgccgtgcgtggaggtcaagcgctgcacgggctgctgcaacaccagcagcatcaagtgc
cagccgacccgcgtgcaccaccgcagcgtcaaggtggccaaggtggagtacgtcaggaag
aagcccaagttgaaggaggtgcaggtgcggctggaggagcacctggagtgcgcgtgcacg
gccgccggcccccgcgaggaggagacgggaaggcgcagggagtcaggtaaaaagcggaaa
agaaagaggttaaaacccacctaa

KEGG   Equus caballus (horse): 100056444
Entry
100056444         CDS       T01058                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17 isoform X3
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100056444 (FGF17)
   04014 Ras signaling pathway
    100056444 (FGF17)
   04015 Rap1 signaling pathway
    100056444 (FGF17)
   04020 Calcium signaling pathway
    100056444 (FGF17)
   04151 PI3K-Akt signaling pathway
    100056444 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100056444 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056444 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    100056444 (FGF17)
   05218 Melanoma
    100056444 (FGF17)
   05224 Breast cancer
    100056444 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100056444 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100056444 (FGF17)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100056444 (FGF17)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100056444 (FGF17)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100056444
NCBI-ProteinID: XP_014593213
Ensembl: ENSECAG00000024690
VGNC: 18014
LinkDB
Position
2
AA seq 205 aa
MGATRLLPNLTLCLQLLILCCQTQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGR
RISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKKGKLIGKPSGKSKDCVFTE
IVLENNYTAFQNARREGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAER
QKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 618 nt   +upstreamnt  +downstreamnt
atgggagccacccgcctgctgcccaacctcactctgtgcttgcagcttctgatcctctgc
tgtcaaactcagtacgtgagggaccagggtgccatgactgaccagctgagcaggcggcag
atccgtgagtaccagctttacagccggaccagtggcaagcacgtgcaggtcaccgggcgt
cgcatctctgccaccgctgaggacggaaacaagtttgccaagctcatagtagagacagac
acatttggaagccgggtgcgcatcaagggggctgagagcgagaagtacatctgcatgaac
aagaagggcaagctcatcgggaagcccagtgggaagagcaaggactgcgtgttcacggag
atcgtgctggagaacaactacacggccttccagaatgcgcggcgtgagggctggttcatg
gccttcacgcggcaggggcggccccgccaggcctcccgcagccgccagaaccagcgagag
gcccacttcatcaagcggctctaccagggccagctgcccttccccaaccatgccgagagg
cagaagcagttcgagtttgtgggctcggcccccacgcgccggaccaagcgcactcggagg
ccacagcccctgacgtag

KEGG   Equus caballus (horse): 100058460
Entry
100058460         CDS       T01058                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100058460 (FGF23)
   04014 Ras signaling pathway
    100058460 (FGF23)
   04015 Rap1 signaling pathway
    100058460 (FGF23)
   04020 Calcium signaling pathway
    100058460 (FGF23)
   04151 PI3K-Akt signaling pathway
    100058460 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100058460 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100058460 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058460 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    100058460 (FGF23)
   05218 Melanoma
    100058460 (FGF23)
   05224 Breast cancer
    100058460 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100058460 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100058460 (FGF23)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100058460 (FGF23)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100058460 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100058460
NCBI-ProteinID: XP_001491469
Ensembl: ENSECAG00000021077
VGNC: 18017
LinkDB
Position
6
AA seq 246 aa
MSGPCLGLLVYVLCSAVKAYPNASPLLDSSWGSLTHLYTATARNSYHLQIHKDGHVDGTP
HQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHHFSPESCSFRQRTLENGYD
VYHSPQHRFLVSLGRAKRAFLPGTNPPPYSQFLSRRNEIPLVHFNTPRPRRHTRSAEDNS
ERDPLNVLKPRPRMTPAPASCSQELPSAEDNSVLASDPLGVVRGNRVNTHAGGAGVERCR
PFPKFF
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcagggccctgccttgggctcctggtctacgtcctgtgctccgcagtgaaagcctat
cccaacgcctccccgctgctagactccagctggggcagcctgacccacctgtacacggcc
acagccaggaacagctaccacctgcagatccacaaggatggccacgtggatggcacaccc
catcagaccatctacagtgccctgatgatcagatcagaggatgctggctttgtggtgata
acaggtgtgatgagcaggagatacctctgcatggacttcagaggaaacatttttggatca
catcacttcagccccgagagctgcagcttccgacagcggacgctggagaacggctacgac
gtgtaccactcgccgcagcatcgcttcctcgtcagcctgggccgcgccaagagggccttc
ctgcccggcacgaaccccccgccctactcgcagttcctgtcccggaggaacgagatcccc
ctggtccacttcaacaccccgcggccgcggcggcacacgcgcagcgccgaggacaactcg
gagcgcgacccgctgaacgtgctgaagccccggccccgcatgacccccgcgccggcctcc
tgctcccaggagctcccgagcgccgaggacaacagcgtgctggccagcgaccccttaggg
gtggtccgtggcaacagggtgaacacgcacgcggggggcgcgggcgtggagcgctgccgc
cccttccccaagttcttctag

KEGG   Equus caballus (horse): 100060219
Entry
100060219         CDS       T01058                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5 isoform X1
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100060219 (FGF5)
   04014 Ras signaling pathway
    100060219 (FGF5)
   04015 Rap1 signaling pathway
    100060219 (FGF5)
   04020 Calcium signaling pathway
    100060219 (FGF5)
   04151 PI3K-Akt signaling pathway
    100060219 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100060219 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060219 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    100060219 (FGF5)
   05218 Melanoma
    100060219 (FGF5)
   05224 Breast cancer
    100060219 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100060219 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100060219 (FGF5)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100060219 (FGF5)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100060219 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100060219
NCBI-ProteinID: XP_001492606
Ensembl: ENSECAG00000015710
VGNC: 18018
LinkDB
Position
3
AA seq 269 aa
MSLSFLLLFLSHLILSAWAHGEKRLAPKGQPGPVATDRNPRGASSSRSGSSTTSSSSSSA
SSSPAASLGSQASGLEQGSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLS
ILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIH
RTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQLEQPELSFTVTVPEKKKA
PNPAKPKVPLSAPRRSPNTVKYRLKFRFG
NT seq 810 nt   +upstreamnt  +downstreamnt
atgagcttgtcctttctcctcctcttcctcagccacctgatcctcagcgcctgggctcac
ggggagaaacgcctcgcccccaaggggcaacccggacccgttgccactgataggaacccg
agaggcgccagcagcagccggagcggcagtagcacgacgtcttcctcctcttcctctgcc
tcctcctcccccgcggcttctctgggcagccaagcaagcggcttggagcagggcagtttc
cagtggagcccctcgggtcgccggaccggcagcctctactgcagagtgggcattggtttc
catctgcagatctacccggatggcaaagtcaatggctcccacgaagccaatatgttaagt
attttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaac
aaatttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagatgac
tgcaagttcagggagcgatttcaagaaaacagctataacacctatgcctcagcaatacac
agaaccgagaaaacgggacgggagtggtatgtggccctgaacaaaagagggaaagctaag
cgaggctgcagcccccgggttaagccccagcacatctctacccacttcctgccaagattc
aagcagttggagcagccagaactttctttcacagtaactgttcctgaaaagaaaaaggca
cctaatcctgccaagccaaaggttcccctttccgcacctcggaggagtcccaacacagtg
aaatacagactcaagtttcgctttggataa

KEGG   Equus caballus (horse): 100060309
Entry
100060309         CDS       T01058                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100060309 (FGF8)
   04014 Ras signaling pathway
    100060309 (FGF8)
   04015 Rap1 signaling pathway
    100060309 (FGF8)
   04020 Calcium signaling pathway
    100060309 (FGF8)
   04151 PI3K-Akt signaling pathway
    100060309 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100060309 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060309 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    100060309 (FGF8)
   05218 Melanoma
    100060309 (FGF8)
   05224 Breast cancer
    100060309 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100060309 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100060309 (FGF8)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100060309 (FGF8)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100060309 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100060309
NCBI-ProteinID: XP_023485525
Ensembl: ENSECAG00000010125
VGNC: 51507
LinkDB
Position
1
AA seq 270 aa
MGSPRSALSCLLLHLLVLCLQAQVRRTARRRGPGGRRGTPVDNVGQGHEDGPCGRRGRAG
RNLSSPAPNYPEEGAKEQRGSALPKVTQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHV
QVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGK
DCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTT
EQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctattgcacttgctggttctctgcctt
caagcccaggtaaggcgcactgcgcggaggcgggggccggggggccggcgggggacgcca
gttgacaatgtcgggcaggggcacgaggacggaccctgcggccggcgcggcagggctgga
aggaaccttagcagtccagccccgaactaccccgaggagggagctaaggaacagagaggt
agcgccctgcctaaggtcacacaacagcatgtgagggagcagagcctggtgacggatcag
ctcagccgccgcctcatccggacctaccagctctacagccgcaccagcgggaagcacgtg
caggtcctggccaacaagcgcatcaacgccatggcggaagacggggaccccttcgcaaag
ctcattgtggagacagatacctttgggagcagggttcgagtccgaggagctgagacgggc
ctctacatctgcatgaacaagaaggggaagctgattgccaagagcaacggcaagggcaag
gattgtgtcttcacggagatcgtgctggagaacaactacacggccctgcagaacgccaag
tacgagggctggtacatggccttcacccgcaagggccggccccgcaagggctccaagacg
cggcagcaccagcgcgaggtccacttcatgaagcggctgccgcgcggccaccacaccacc
gagcagagcctgcgcttcgagttcctcaactacccgcccttcacgcgcagcctgcgcggc
agccagaggacttgggcccccgagccccgatag

KEGG   Equus caballus (horse): 100060488
Entry
100060488         CDS       T01058                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100060488 (FGF19)
   04014 Ras signaling pathway
    100060488 (FGF19)
   04015 Rap1 signaling pathway
    100060488 (FGF19)
   04020 Calcium signaling pathway
    100060488 (FGF19)
   04151 PI3K-Akt signaling pathway
    100060488 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100060488 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060488 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    100060488 (FGF19)
   05218 Melanoma
    100060488 (FGF19)
   05224 Breast cancer
    100060488 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100060488 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100060488 (FGF19)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100060488 (FGF19)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100060488 (FGF19)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100060488
NCBI-ProteinID: XP_023510391
LinkDB
Position
12
AA seq 219 aa
MRSAPSQCAVACALVLAGLWLAAAGRPLALSDAGPHVHYGWGEPIRLRHLYTAGPHGLSS
CFLRIRADGAVDCARGQSAHSLVEIRAVALRTVAIKGVHSVRYLCMGADGRMQGLPQYSA
EDCAFEEEMRPDGYTVYHSRKHHLPVSLSSAKQRQLLKGKGLLPLSHFLPMLPRGPAEPR
ELQDHVEPDVFSSPLETDSMDPFGIATKVGLVKSPSFQK
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcggagcgcaccgagccagtgcgccgtggcctgcgccctagtcctggccggcctctgg
ctggccgcggccgggcgccccctagccttgtccgacgctgggccgcacgtgcactacggc
tggggcgagccgatccgcctgcggcacctgtacaccgccggcccccacggcctctccagc
tgcttcctgcgcatccgcgccgatggcgccgtggactgcgcgcggggccagagcgcgcac
agtttggtggagatcagagcagtcgctctgcgcaccgtggccatcaagggcgtgcacagc
gtccggtacctctgcatgggcgccgacggcaggatgcaagggctgccccagtactcggcc
gaggactgcgccttcgaggaggagatgcggcccgacggctacaccgtgtaccactcccgg
aagcaccacctcccggtctccctgagcagcgccaagcagaggcagctgctgaagggcaag
gggctcctgccgctgtcccacttcctgcccatgctgcccaggggcccagcggagcccagg
gagctccaggaccacgtggagcccgatgtgttttcttcacccctggagacagacagcatg
gaccctttcgggatcgccaccaaagtgggactggtgaagagccccagctttcagaaatag

KEGG   Equus caballus (horse): 100060525
Entry
100060525         CDS       T01058                                 

Gene name
FGF4
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100060525 (FGF4)
   04014 Ras signaling pathway
    100060525 (FGF4)
   04015 Rap1 signaling pathway
    100060525 (FGF4)
   04020 Calcium signaling pathway
    100060525 (FGF4)
   04151 PI3K-Akt signaling pathway
    100060525 (FGF4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100060525 (FGF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060525 (FGF4)
  09162 Cancer: specific types
   05226 Gastric cancer
    100060525 (FGF4)
   05218 Melanoma
    100060525 (FGF4)
   05224 Breast cancer
    100060525 (FGF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100060525 (FGF4)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100060525 (FGF4)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100060525 (FGF4)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100060525 (FGF4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100060525
NCBI-ProteinID: XP_023510734
LinkDB
Position
12
AA seq 206 aa
MAGPGAAAAALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECKFKETLLANNYNAYECHQHPGMFIA
LSKNGKPKKGNRVSPTMKVTHFLPRL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcggggcccggggcggccgcggcggcgctgctcccggcggtcctgctggccctgctg
gcgccctgggccggccgagggggcgccgccgcgcccaccgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgcgctcgctggcgcgcctgcccgtg
gccgcgcagcccaaggaggcggccgtccagagcggcgccggggactacctgctgggcatc
aagcggctgcggcggctctattgcaatgtgggcatcggcttccacctccaggtgctcccc
gacggccgcatcgggggcgtgcacgcggacacgagcgacagcctgctggagctctcgccg
gtggagcggggcgtggtgagcatcttcggcgtggccagcaggttcttcgtggccatgagc
agcaagggcaagctgtacggctcgcctttcttcaccgacgagtgcaagttcaaggagact
ctcctcgccaacaactacaatgcctatgagtgccaccagcaccccggcatgttcatcgcc
ctgagcaagaacgggaagcccaagaaggggaaccgagtgtcacccaccatgaaggtcacc
cacttcctccccaggctgtga

KEGG   Equus caballus (horse): 100061488
Entry
100061488         CDS       T01058                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04810  Regulation of actin cytoskeleton
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100061488 (PDGFD)
   04014 Ras signaling pathway
    100061488 (PDGFD)
   04015 Rap1 signaling pathway
    100061488 (PDGFD)
   04020 Calcium signaling pathway
    100061488 (PDGFD)
   04072 Phospholipase D signaling pathway
    100061488 (PDGFD)
   04151 PI3K-Akt signaling pathway
    100061488 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100061488 (PDGFD)
   04540 Gap junction
    100061488 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100061488 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100061488 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    100061488 (PDGFD)
   05215 Prostate cancer
    100061488 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100061488 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100061488 (PDGFD)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100061488 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 100061488
NCBI-ProteinID: XP_014596808
Ensembl: ENSECAG00000024746
VGNC: 21260
LinkDB
Position
7
AA seq 370 aa
MHRLILIYTLVCANFCSYRDTSAIPQSASIKALRSANLRRDESNHLTDLYRRDETIQVTG
NGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSISGVSYHSPSVTDPTLTADALDKTVAEFDTVEDLLKHFNPESWQEDLENLY
LDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNVVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCNSGKTVKKYHEVLKFEPGHFKRRSRAKHMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccggctcatcctcatctacactctagtctgcgcaaacttttgcagctatcgggac
acttctgcaattccgcagagcgcatccatcaaagctctgcgcagcgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagatgaaaccatccaggtgacagga
aacggccatgtgcagagtccccgcttcccgaacagctaccccaggaacctgcttctgaca
tggcggctccattcccaggagaaaacaaggatacagctggcctttgataatcagtttgga
ttagaggaagcagaaaatgatatctgtaggtatgattttgtggaagttgaagatatatct
gaaaccagtaccattattagaggacgatggtgtggacacaaggaggttcctccaaggata
acatcaagaacaaaccaaattaaaataacattcaagtctgatgactactttgtggctaaa
cctggattcaagatttattattcttttgtggaagatttccaacccgcagcagcctcagag
accaactgggagtcagtcacaagctctatctcaggggtgtcctatcactctccatcagtg
acggatcccactctcacggcggatgctctggacaagacagttgcagaatttgatactgtg
gaagacctgctcaagcacttcaaccccgaatcatggcaagaagatcttgagaatttgtat
ttggacacccctcattatcgaggcaggtcgtaccatgacaggaagtcgaaagttgacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaattactcggtcaac
ttaagagaggagctgaagctgaccaacgtcgtcttctttccacgttgcctccttgtgcag
cgctgtggaggaaattgtggctgtggaaccgtcaactggaagtcctgtacgtgtaattca
gggaagactgtgaaaaagtatcacgaggtattaaagtttgaacctggccatttcaagagg
aggagcagagcgaagcacatggctctcgttgacatccagttggatcaccatgagcggtgt
gattgtatctgcagctcaagaccacctcgataa

KEGG   Equus caballus (horse): 100062015
Entry
100062015         CDS       T01058                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C isoform X2
  KO
K05450  platelet derived growth factor C/D
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04810  Regulation of actin cytoskeleton
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100062015 (PDGFC)
   04014 Ras signaling pathway
    100062015 (PDGFC)
   04015 Rap1 signaling pathway
    100062015 (PDGFC)
   04020 Calcium signaling pathway
    100062015 (PDGFC)
   04072 Phospholipase D signaling pathway
    100062015 (PDGFC)
   04151 PI3K-Akt signaling pathway
    100062015 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100062015 (PDGFC)
   04540 Gap junction
    100062015 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100062015 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100062015 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    100062015 (PDGFC)
   05215 Prostate cancer
    100062015 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100062015 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100062015 (PDGFC)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100062015 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 100062015
NCBI-ProteinID: XP_001500695
Ensembl: ENSECAG00000019512
VGNC: 21259
UniProt: A0A3Q2HV05
LinkDB
Position
2
AA seq 345 aa
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMDLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSALPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKNGVRGLHKSLTDVALEHHEECDCVCRGNSGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcttcgggcttctcctgctgacatctgccctggccggccagagacacgggact
caggctgagtccaacctcagtagtaaattccagttctccagcaacaaggaacagaacgga
gtacaagatccccagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaaggtttcctcatacttatccaagaaatatggacttggtgtggagattagtagcagta
gaggaaaatgtatggatacaacttacctttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaacgatatta
gggcgctggtgtggttctggcactgtgccaggaaaacagatttctaaaggaaatcaaatc
aggataagatttgtttctgatgaatattttccttctgaaccggggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagcgttacccccttcagct
ttgccactggacctgcttaataacgctgtcactgcctttagtaccttggaagatcttatt
cggtatcttgaaccagatagatggcagttggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtatttggaagaaaatccagagtggtggatctgaacctt
ctgaaagaggaggtaagattatacagctgcacacctcgtaacttctcggtgtccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgc
ggtggaaactgtgcctgttgccttcacaattgcaacgagtgtcagtgtgtcccaagcaaa
gttactaaaaaatatcatgaggtccttcagttgagaccaaagaatggtgtcaggggattg
cataaatctctcacggatgtggccctggagcaccatgaggagtgtgactgtgtatgcaga
gggaactctggaggataa

KEGG   Equus caballus (horse): 100070283
Entry
100070283         CDS       T01058                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05231  Choline metabolism in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100070283 (PDGFB)
   04014 Ras signaling pathway
    100070283 (PDGFB)
   04015 Rap1 signaling pathway
    100070283 (PDGFB)
   04630 JAK-STAT signaling pathway
    100070283 (PDGFB)
   04020 Calcium signaling pathway
    100070283 (PDGFB)
   04072 Phospholipase D signaling pathway
    100070283 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100070283 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100070283 (PDGFB)
   04540 Gap junction
    100070283 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100070283 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070283 (PDGFB)
   05206 MicroRNAs in cancer
    100070283 (PDGFB)
   05231 Choline metabolism in cancer
    100070283 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100070283 (PDGFB)
   05218 Melanoma
    100070283 (PDGFB)
   05211 Renal cell carcinoma
    100070283 (PDGFB)
   05215 Prostate cancer
    100070283 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100070283 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100070283 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100070283 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100070283 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100070283 (PDGFB)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100070283 (PDGFB)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100070283 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100070283
NCBI-ProteinID: XP_023486879
LinkDB
Position
28
AA seq 242 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSVDEDGAEL
DLNLTRSHAGGEPDSLSRGRRSLGSLAVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRHVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKC
ETVGAARPVTRNPGSSQEQRAAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatcgttgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcctgaggagctctacgagatgctgagcgaccactcgatccgctcc
ttcgatgacctccagcgcctgctgcacggagactccgtagatgaagacggggccgagctg
gacctgaatctgacgcggtcccatgctggaggcgagccggacagcttatcccgcgggaga
aggagcctaggttccctggccgttgccgagccagccatgatcgccgagtgcaagactcgc
accgaggtgttcgagatctcccggcgcctcatcgaccgcaccaacgccaacttcctggtg
tggccgccctgcgtggaggtccagcgctgctccggctgctgcaacaaccgccacgtgcag
tgccggcccacccaggtgcagctgcggcccgtgcaggtgagaaagatcgagatcgtgcgg
aagaagccgacattcaagaaggccacagtgactctggaagaccacctggcctgcaagtgt
gagacggtgggggccgcacgacccgtgacccgaaaccccgggagttcccaggagcagcga
gcagccaagacgcctcaaactcgggtgaccattcggacggtgcgcgtccgccggcccccc
aaggggaagcaccggaagttcaagcacacacatgacaagaaggcactgaaggagaccctc
ggagcctag

KEGG   Equus caballus (horse): 100071790
Entry
100071790         CDS       T01058                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100071790 (FGF16)
   04014 Ras signaling pathway
    100071790 (FGF16)
   04015 Rap1 signaling pathway
    100071790 (FGF16)
   04020 Calcium signaling pathway
    100071790 (FGF16)
   04151 PI3K-Akt signaling pathway
    100071790 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100071790 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100071790 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    100071790 (FGF16)
   05218 Melanoma
    100071790 (FGF16)
   05224 Breast cancer
    100071790 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100071790 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100071790 (FGF16)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100071790 (FGF16)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100071790 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100071790
NCBI-ProteinID: XP_023489825
VGNC: 18013
LinkDB
Position
X
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtggggggggtcttcgcctccttggactgggacctgcacggcttctcctcc
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctgtactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggcc
gtggggctgatcagcatccggggagtggactctggcctgtacttaggaatgaacgagcga
ggagaactatatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaattggtacaacacctatgcctccaccttgtacaaacactcggattcggagagacag
tattatgtggccctgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggccagtagatccttctaagttgccctccatgtcc
agagacctcttccgctataggtaa

KEGG   Equus caballus (horse): 100072461
Entry
100072461         CDS       T01058                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100072461 (FGF22)
   04014 Ras signaling pathway
    100072461 (FGF22)
   04015 Rap1 signaling pathway
    100072461 (FGF22)
   04020 Calcium signaling pathway
    100072461 (FGF22)
   04151 PI3K-Akt signaling pathway
    100072461 (FGF22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100072461 (FGF22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100072461 (FGF22)
  09162 Cancer: specific types
   05226 Gastric cancer
    100072461 (FGF22)
   05218 Melanoma
    100072461 (FGF22)
   05224 Breast cancer
    100072461 (FGF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100072461 (FGF22)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100072461 (FGF22)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100072461 (FGF22)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100072461 (FGF22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100072461
NCBI-ProteinID: XP_023500038
LinkDB
Position
7
AA seq 170 aa
MRGRLWLGLAWLLLARAPGAAGTPGGPRRARSYPHLEGDVRWRRLFSSTHFFLGVDPSGR
VQGTRWRHSPDSVLEIRSLRVGVVALKAVHTGFYVAMSRRGRLYGSRVCTAHCSFRERIE
ENGYNTYASVRWRHRGRPMFLALDGQGAPRRGGRTRVHHLSTHFLPVLVS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcgcggccgcctgtggctgggcctggcgtggctgctgctggcgcgggcgcccggcgcc
gcggggacccccggcggtccgcggagagcgcgcagctacccgcacctggagggcgacgtg
cgctggcggcgcctcttctcctccacccacttcttcctgggcgtggaccccagcggccgc
gtgcagggcacccgctggcgccacagccctgacagcgtcctggagatccgctccctccgc
gtgggtgttgtggccctcaaggccgtgcacaccggcttctacgtggccatgagccgccgg
ggccgcctctacgggtcgagggtctgcaccgcccactgcagtttccgggagcgcattgag
gagaacggctacaacacatacgcctcggtccgctggcgccaccgtggccggcccatgttc
ctggcgctggacgggcagggggccccgcgtcgtggtggccggacgcgggtgcaccaccta
tccacccacttcctgcccgtcctggtgtcttga

KEGG   Equus caballus (horse): 100146649
Entry
100146649         CDS       T01058                                 

Gene name
FGF3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100146649 (FGF3)
   04014 Ras signaling pathway
    100146649 (FGF3)
   04015 Rap1 signaling pathway
    100146649 (FGF3)
   04020 Calcium signaling pathway
    100146649 (FGF3)
   04151 PI3K-Akt signaling pathway
    100146649 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100146649 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100146649 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100146649 (FGF3)
   05218 Melanoma
    100146649 (FGF3)
   05224 Breast cancer
    100146649 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100146649 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100146649 (FGF3)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100146649 (FGF3)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100146649 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100146649
NCBI-ProteinID: XP_023510735
LinkDB
Position
12
AA seq 231 aa
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
NGRVNGSLENSAYSILEITAVEVGIVAIKGLFSGRYLAMNERGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTLPGGPGVRRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHKDHEMLRLLQSGAGLRGGPPGKAAQPRRRRQRHRHRVDPRPDGSGT
NT seq 696 nt   +upstreamnt  +downstreamnt
atgggcctgatttggctcctgcttctcagcctcctggagcccggctggcccgccgcgggc
cccggggcgcggctgcggcgcgatgcgggcggccgcggcggcgtctacgagcacctcggc
ggggcgccccggcgccgcaaactctactgcgccaccaagtaccacctccagctacaccca
aacggccgcgtcaacggcagcctggagaacagcgcttacagtatcctggagataacggca
gtggaggtgggcattgtggccatcaagggcctcttctccgggcggtacctggccatgaac
gagcggggccggctctacgcttcggaacactacagcgcggagtgcgagttcgtggagcgg
atccacgagctgggctacaacacgtacgcctcgcggctgtaccggacgctgcccggcggg
cccggggtgcggcggcagcccagcgctgagagactgtggtacgtgtcggtgaacggcaaa
ggccggccccgcaggggcttcaagacgcgccgcacgcagaagtcctcgctgttcctgccc
cgcgtgctggaccacaaggaccacgagatgctgcggctgctccagagcggggctgggctc
cgcggtgggccaccgggcaaggccgcccagccccggcggcggcgacagcggcataggcac
cgtgtagacccccggcctgatggaagcgggacctga

KEGG   Equus caballus (horse): 100629648
Entry
100629648         CDS       T01058                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100629648 (FGF18)
   04014 Ras signaling pathway
    100629648 (FGF18)
   04015 Rap1 signaling pathway
    100629648 (FGF18)
   04020 Calcium signaling pathway
    100629648 (FGF18)
   04151 PI3K-Akt signaling pathway
    100629648 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100629648 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100629648 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    100629648 (FGF18)
   05218 Melanoma
    100629648 (FGF18)
   05224 Breast cancer
    100629648 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100629648 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100629648 (FGF18)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100629648 (FGF18)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100629648 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100629648
NCBI-ProteinID: XP_023473014
LinkDB
Position
14
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQTELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggcggccgaggagaacgtggacttccgcatccatgtagagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagtgggaagcacatccaggtcctgggccgcaggatcagtgcccgaggcgaggacggg
gacaagtatgcccagctcctagtggagacagacacctttggtagccaagtccggatcaag
ggcaaggagacggaattctacctgtgtatgaaccggaaaggcaagctcgtggggaagcct
gatggcaccagcaaggagtgtgtgttcattgagaaggtcctggaaaacaactacacagcc
ctgatgtcggccaagtactccggctggtacgtgggcttcaccaagaaggggcggccacgg
aagggccccaagacccgggagaaccagcaggacgtgcacttcatgaagcgctaccccaag
gggcagacggagctgcagaagcccttcaaatacaccacggtgaccaagaggtcccggcgg
atccgccccacacaccccggctag

KEGG   Equus caballus (horse): 106782874
Entry
106782874         CDS       T01058                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05160  Hepatitis C
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05226  Gastric cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106782874 (EGF)
   04012 ErbB signaling pathway
    106782874 (EGF)
   04014 Ras signaling pathway
    106782874 (EGF)
   04015 Rap1 signaling pathway
    106782874 (EGF)
   04630 JAK-STAT signaling pathway
    106782874 (EGF)
   04066 HIF-1 signaling pathway
    106782874 (EGF)
   04068 FoxO signaling pathway
    106782874 (EGF)
   04020 Calcium signaling pathway
    106782874 (EGF)
   04072 Phospholipase D signaling pathway
    106782874 (EGF)
   04151 PI3K-Akt signaling pathway
    106782874 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106782874 (EGF)
   04540 Gap junction
    106782874 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106782874 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106782874 (EGF)
   05231 Choline metabolism in cancer
    106782874 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106782874 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106782874 (EGF)
   05212 Pancreatic cancer
    106782874 (EGF)
   05226 Gastric cancer
    106782874 (EGF)
   05214 Glioma
    106782874 (EGF)
   05218 Melanoma
    106782874 (EGF)
   05219 Bladder cancer
    106782874 (EGF)
   05215 Prostate cancer
    106782874 (EGF)
   05213 Endometrial cancer
    106782874 (EGF)
   05224 Breast cancer
    106782874 (EGF)
   05223 Non-small cell lung cancer
    106782874 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106782874 (EGF)
   05165 Human papillomavirus infection
    106782874 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106782874 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    106782874 (EGF)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   106782874 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 Plasmod_Pvs28 Tr-sialidase_C
Other DBs
NCBI-GeneID: 106782874
NCBI-ProteinID: XP_014593426
Ensembl: ENSECAG00000010741
VGNC: 17456
LinkDB
Position
2
AA seq 1209 aa
MLLFLSTLLPAVFAAAFVSVSARPRWDCPAGPPSGKGHSPCVGPVPFLIFSYGNSIFRID
LEGTNHEQLVTDAGISVIMDFHYNKGRIYWVDLARQLLQSVLLNGTRQERICNIERNVSG
MAINWINEELIWSNQEEGVITVTDMKGNNSRVLLGTLKSPANIAVDPVERLLFWSSEAAG
SLHRADLNGVEEKVLLETSGKITAVSLDVLEKRLFWIQYDREGDNSRVCSSDYDGGSVRC
CKHLTQHNLVAVSLFGDRIFYSTWRKQTIEIADKYTGKDVVRINLSRSFAPPAGIKAVHP
LMQPEADGGAQASDQKVCKLRKSDCRGSVCGQDPKSHLCACVEGYTLSQDGKSCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHELISCPSNASECSHDCVLTSDGPL
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCIPLSPASWECSCFPGYDLQLDQKSCAASG
PQPFLLFANSKDIRHMRFDGTDYGILLSQQMGAVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLVEEAVDVPEGLAVDWIGRKLYWTDRGKALIEGSDLNGKFREIIVREDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGTGRLVIVSSDLAWPSGITIDYLTDKLYWCD
AKKSVIEMADLDGSKRRRLAQNDVGHPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVIVHPLAKPGADPCSHQNGGCEHTCKERFGTAQCLCREGFMKAPDGKMC
LALNGHQILAGSEADLSGQTTPLGILSRSRGCEDNISESQQMLVAEIMVSDDDDCGPVRC
GPHAQCVSEGEEAICQCFKGFAGDGQLCSDVDECEVGNLVCPHPSSRCVNTEGGYVCQCS
EGYRGDGMHCLDIDECQLGMHTCGENASCTNTEGNYTCLCAGGLSGPGWICPNSTVPSPP
REDGHYSVRNSYQECSQSYDGYCLHGGKCVYLVQVDTHACNCVVGYVGERCQHQDLRWWE
LRHTGHGWPRSITVVAVCMVVLILLLLLGLWGAHYHRAQKLLLKNPKNPYEESSRDMSGN
RPADSEAGMSSCPQPWFVVIKEQQQNLRSGDQPVHPKDGETADVGQFSSLEPGSLQQTSW
RKEPQMYTGTEQGCCIPPSSGKGSGPQAMECSFHLPSYGARPAATGVEKPHSLLSANPLW
QQRAPDPPL
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgctgctcttccttagcactctgttgccagcagtttttgcagctgctttcgttagcgtc
tccgcacggccgcgctgggactgtcctgcaggccctccctcgggaaaggggcattctccc
tgtgtgggtcctgtgcccttcttaattttctcctatggaaatagtatctttaggattgat
ctggaaggaactaatcatgagcaattggtgacagatgctggcatatcggtcatcatggat
tttcattacaacaagggaagaatctattgggtagatctagcaagacaacttttgcaaagc
gttcttctgaatgggacaaggcaagagagaatatgcaatatagagagaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaagaggaaggagtcatt
acagtaacagatatgaaaggaaacaattcccgtgttctcttgggcaccttaaaatctcct
gcaaacatagcagttgatccagtagaaaggcttctcttctggtcttcagaggcggccggc
agcctccacagagcagatctcaatggtgtggaagagaaggttctgttagagacatcaggg
aaaataacagctgtgtcactggatgtgcttgagaagcggctcttttggattcagtacgac
agagagggcgacaattcccgtgtttgttccagcgattatgacggagggtctgtccgttgc
tgcaaacatcttacacagcacaacttggttgcagtgtccctctttggtgaccgtatcttc
tattcaacgtggagaaaacagacaattgagatagctgacaaatacactgggaaggatgtg
gttagaattaacctcagtcggtcctttgcaccacctgctggaattaaagctgtgcatccc
ctcatgcagcctgaggcagatggcggtgcgcaggcatctgaccagaaagtctgcaaactg
aggaaaagtgactgcagaggcagcgtgtgtgggcaagaccctaagtcccatctgtgcgca
tgtgtggagggatatactttaagccaagacgggaagtcctgtgaagatgtcaatgaatgt
gccttttggaatcatggctgtactcttgggtgtgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatgggaaacggtgtcatgaattaatttcc
tgcccaagcaacgcatccgaatgcagccatgactgtgttctgacctcagatgggcccctg
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacgtgtagtggctgttca
tcacctgataacggtggatgcagccagctctgcatcccgctcagcccagcatcctgggaa
tgtagttgctttcctggctacgacctacaattggaccagaaaagttgtgcagcttcagga
ccacaaccgtttttgctgtttgccaattctaaagatattcgacacatgcgttttgatgga
acagattatggaatcctgctcagccagcagatgggggcagtttttgccctagatcatgac
cctgtggaaaataagatctactttgcccatacagccctgaagtggatcgagagagctaac
atggatggttcccagcgagaaaggcttgttgaggaagccgttgatgtgccagaaggtctt
gctgtagactggattggccgcaaactctactggacagacagagggaaagctctcattgaa
gggagtgatttaaatggaaaattccgtgaaatcatcgttcgggaggacatctctcagcca
cgaggcattgctgtccatcccatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttcccttcaaggcactggccgtctggttatagttagctctgat
ctggcctggcccagtggaataacgattgattacttaactgacaagttgtattggtgcgat
gccaagaagtctgtgatagaaatggccgatctggatggttcaaaacgccgaagacttgcc
cagaacgatgtagggcacccgtttgctgtggccgtgtttgaggatcacgtgtggttctct
gattggactgtgccatcagtaataagggtgaacaagcggactggcaaaaacagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttatagttcatccattggcaaaacca
ggagcagatccctgctcacatcaaaatggaggctgtgaacacacctgcaaagaaaggttt
ggaactgctcagtgtttgtgtcgtgaaggttttatgaaagccccagatgggaaaatgtgt
ctggctctgaatggccatcagatattggcaggtagtgaagcagatctaagtggtcaaaca
acgccattgggcatcttatccaggagtagagggtgtgaagataacatttcagaatctcag
caaatgctagtggctgaaatcatggtgtcagatgatgatgactgtggccccgtgcgatgc
ggtccccacgcccagtgtgtttcagagggagaggaggccatatgtcagtgtttcaaagga
ttcgctggggatggacagctatgttctgatgtggatgaatgtgaggtgggaaacttggtg
tgcccccacccctcctctcggtgcgtcaacactgaaggtggctatgtctgccagtgctcg
gaaggctaccgaggcgatgggatgcattgtctagatattgatgagtgccaactgggcatg
cacacctgtggagaaaatgccagctgtacaaatacagaaggaaactatacctgcctgtgt
gctggtggcctgtctggacctggatggatttgccccaactcgactgtaccctctcctccc
agggaggatggccactactctgtgagaaatagttaccaggaatgttcccagtcctatgac
gggtactgcctccacggtggcaagtgtgtgtatcttgtacaagtcgacacacatgcgtgc
aactgtgttgttggctacgtcggagagcgatgtcagcaccaggacttgaggtggtgggaa
ctgcgccacaccggccacgggtggccccggagcatcaccgtggtggccgtctgcatggtg
gtgctcatcctgctgctgctgctgggcctgtggggggctcactaccacagggctcagaag
ctgctattgaaaaatccaaagaatccttatgaagagtcaagcagagatatgagcggcaac
aggcctgcagacagcgaggctggcatgtcctcttgcccccaaccttggtttgtggttata
aaggaacaacagcaaaacctcaggagtggggatcaacctgtgcaccccaaggacggcgag
acagcagatgttggccagttttcctccctggagcctgggtcattgcaacagacatcgtgg
aggaaggagccccagatgtatacgggcacagaacaaggttgctgcattccaccgtccagt
ggcaaaggctccgggccccaggcaatggagtgtagctttcatctcccctcctatggggca
cggcccgctgctacgggggttgagaagcctcattctctcctgtcagctaacccgttatgg
caacagagagccccagatccaccgctctaa

DBGET integrated database retrieval system