KEGG   Equus caballus (horse): 100033960
Entry
100033960         CDS       T01058                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04390  Hippo signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05200  Pathways in cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100033960 (FGF1)
   04014 Ras signaling pathway
    100033960 (FGF1)
   04015 Rap1 signaling pathway
    100033960 (FGF1)
   04390 Hippo signaling pathway
    100033960 (FGF1)
   04151 PI3K-Akt signaling pathway
    100033960 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100033960 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033960 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100033960 (FGF1)
   05218 Melanoma
    100033960 (FGF1)
   05224 Breast cancer
    100033960 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100033960 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100033960 (FGF1)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100033960 (FGF1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100033960 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100033960
NCBI-ProteinID: NP_001157358
Ensembl: ENSECAG00000020769
VGNC: 18008
UniProt: F6WDN0
LinkDB
Position
14
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaatcacaaccttcacggccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaatgggggccacttcctgaggatc
cttccagatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggctgttgtacggctcacagacaccaaacgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcatgcagagaag
aactggttcgttggtctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
gggcagaaagcaatcttgtttcttcccctgcccgtctcctctgactaa

DBGET integrated database retrieval system