KEGG   Equus caballus (horse): 100034080
Entry
100034080         CDS       T01058                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb04911  Insulin secretion
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04922  Glucagon signaling pathway
ecb04931  Insulin resistance
ecb04976  Bile secretion
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100034080 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100034080 (SLC2A1)
   04922 Glucagon signaling pathway
    100034080 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100034080 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100034080 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100034080 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100034080 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100034080 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100034080 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100034080 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100034080 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100034080 (SLC2A1)
Transporters [BR:ecb02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100034080 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100034080 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Hanta_G1 DUF2127 DUF523 TRI12
Other DBs
NCBI-GeneID: 100034080
NCBI-ProteinID: NP_001157443
Ensembl: ENSECAG00000000303
VGNC: 23139
UniProt: F7CBT8
LinkDB
Position
2
AA seq 492 aa
MDPSSKKLTGRLMLAVGGAVLGSLQYGYNTGVINAPQKVIEEFYNETWIHRYGEPILPST
LTTLWSLSVAIFSIGGMLGAFSVGLFVNRFGRRNSMLMVNLLAFVAAVLMGFSKLGKSFE
MLILGRFIIGVYSGLSTGFVPMYVGEVSPTALRGALGTLHQLSVVIGILIAQVFGLDSIM
GNEELWPLLLSITFLPAVVQCVLLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEESRQMMREKKVTILELFRSPTYRQPILIAVMLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGAGIVNTAFTVVSLFVVERAGRRTLHLIGLGGMAGCAVLMTIAVALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVSGFSNWASNFLVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggatcccagcagcaagaagctgacgggccgcctcatgctggccgtgggaggggcagtg
cttggctccctgcagtatggctacaacactggagtcatcaacgccccccagaaggtgatc
gaggaattctacaacgagacctggatccaccgctacggggagcccatcttgccctccaca
ctcaccacgctctggtccctctccgtggccatcttctccatagggggcatgcttggagcc
ttctctgtgggcctttttgttaaccgctttggccggcggaattcgatgctgatggtgaac
ctgctggcgttcgtggccgctgtgctcatgggcttctcaaaactgggcaagtcctttgag
atgctgatcctgggccgtttcatcatcggtgtgtacagcggcctgagcacgggcttcgtg
cccatgtacgtgggggaggtgtcccccacggcccttcgtggggccctgggcaccctgcac
cagttgagtgtcgtcatcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaatgaggagctgtggcccctgctgctgagcatcaccttcctcccggccgtggtgcag
tgcgtcctgctgcccttctgccccgagagcccccgcttcctgctcatcaaccgcaatgag
gagaaccgggccaagagtgtgctgaagaagctgcgcggaacggcagacgtgacccgagac
cttcaggagatgaaggaggagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcgcccacctaccgccagcccatcctcatcgctgtgatgctgcagctg
tcccagcagctgtcaggcatcaacgctgttttctattactccacaagcatcttcgagaaa
gcgggggtgcagcagcctgtgtacgccaccatcggcgctggcattgtcaacacagccttc
actgtcgtgtcgctgtttgtggtggaacgagccggccggcggaccctgcacctcataggc
ctgggtggcatggcgggctgtgctgtgctcatgaccatcgccgtggcactgctggagcag
ctgccctggatgtcctatctgagcatcgtggccatctttggctttgtggccttctttgaa
gtgggccccggccccatcccttggttcattgtggctgaactctttagccagggtcctcgc
cctgctgccattgctgtctctggcttctccaactgggcctcaaatttccttgtgggcatg
tgcttccagtacgtggagcaactctgtggtccctatgtcttcatcatcttcaccgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcccgagaccaaaggccggaccttc
gatgagattgcttctggtttccggcaggggggagccagccaaagtgacaagacacccgag
gagctcttccaccccctgggggctgattcccaagtgtga

DBGET integrated database retrieval system