KEGG   Equus caballus (horse): 100034116Help
Entry
100034116         CDS       T01058                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00030  Pentose phosphate pathway
ecb00051  Fructose and mannose metabolism
ecb00052  Galactose metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01230  Biosynthesis of amino acids
ecb03018  RNA degradation
ecb04152  AMPK signaling pathway
ecb05230  Central carbon metabolism in cancer
Module
ecb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100034116 (PFKM)
   00030 Pentose phosphate pathway
    100034116 (PFKM)
   00051 Fructose and mannose metabolism
    100034116 (PFKM)
   00052 Galactose metabolism
    100034116 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100034116 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100034116 (PFKM)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100034116 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ecb01009]
    100034116 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ecb03019]
    100034116 (PFKM)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100034116 (PFKM)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100034116 (PFKM)
Messenger RNA biogenesis [BR:ecb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100034116 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100034116
NCBI-ProteinID: NP_001075391
Ensembl: ENSECAG00000015087
UniProt: Q867C9
LinkDB All DBs
Position
6
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKLGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSNYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
DHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPITSESIKDLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEATPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMAERKFDEAMKLRGRSFMNNWEVYKLLAHIRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGRIEEAGWSYVGGWTGQGGSKLGTKRTLPRKSFEQ
ISANITKFNIQGLIIVGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYSTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEAPA
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggatcggcaaagccatcgccgtg
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatcttcactggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagaccacatcagggaggccacctgggagagcgtttcgatgatgcttcagctgggt
ggcacagtgattggaagtgcccggtgcaaggactttcgggaacgagagggacgactccga
gctgcccacaacctggtgaagcttgggattaccaacctgtgtgtcattgggggcgatggt
agcctcactggggctgacaccttccgttctgagtggagtgacttgttgagtgacctccag
aaagcgggtaagatcacagctgaggaggctacgaagtccaactacctgaacatcgtgggc
ctggttggctcaattgacaatgacttttgcggcactgatatgaccattggcactgactct
gccctgcaccggatcatagagattgtagacgccatcactactactgctcagagccaccag
aggacgttcgtgttagaggtgatgggccggcactgtggatacctggcccttgtcacctct
ctctcctgtggggccgactgggtttttattcctgaatgtccaccagatgatgactgggag
gatcatctttgtcgtcggctcagtgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcgattgacaggaatgggaaaccaatcacctcagaatccatcaag
gatctggtggtaaagcgtctgggatatgacacccgggtcaccgtcttggggcatgtgcag
cgaggtgggaccccgtcagcctttgaccggatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggcgaccccagacaccccagcctgcgtggtgagcctctctggt
aatcaggctgtgcggctgcccctcatggagtgtgtccaggtgaccaaagatgtgaccaag
gccatggctgagaggaaatttgatgaggccatgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcacatcagacccccagtttctaagagtggctca
cacacagtggccgtgatgaatgtgggggccccggctgcaggcatgaatgctgccgtccgc
tccactgtgagaattggcctcatccagggcaaccgagtgctggttgtgcacgatggcttc
gagggcctggccaagggcagaattgaggaagctggctggagctacgttggcggctggact
ggccaagggggttctaaacttgggactaaaaggacgctacccaggaagagcttcgagcag
atcagtgccaacatcactaagttcaacattcaaggcctgatcatcgttgggggcttcgag
gcttacacagggggcctggagctgatggagggcaggaagcagtacgacgagctctgcatc
ccgtttgtggtcatccctgccacggtctccaacaacgtccctggctcagacttcagcgtg
ggggctgacaccgcactcaatactatctgcatgacctgtgaccgcatcaagcagtcagca
gcaggtaccaagcgtcgagtgtttatcattgaaaccatgggtggctactgtggctacctg
gctaccatggcaggactggcagctggagccgatgcggcctacattttcgaggagccattc
accattcgagacctgcaggtgaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgagaagtgcaatgagaactatagcactgacttcatt
ttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggc
cacatgcagcagggtgggagcccaactccatttgataggaattttgccactaagatgggt
gccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaataccccagactcaggctgtgttctggggatgcgtaagagggccctggtcttt
caaccagtgactgagctgaaggaacagacggatttcgagcaccgcatccccaaggaacag
tggtggctgaagctgaggcccatcctcaagatcctagccaagtatgagattgacctggat
acatcagagcacgcccacctggagcacatcagtcggaagcggtctggagaagctcctgcc
taa

DBGET integrated database retrieval system