KEGG   Equus caballus (horse): 100034127
Entry
100034127         CDS       T01058                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04640  Hematopoietic cell lineage
ecb04916  Melanogenesis
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100034127 (KITLG)
   04014 Ras signaling pathway
    100034127 (KITLG)
   04015 Rap1 signaling pathway
    100034127 (KITLG)
   04072 Phospholipase D signaling pathway
    100034127 (KITLG)
   04151 PI3K-Akt signaling pathway
    100034127 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100034127 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100034127 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100034127 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100034127 (KITLG)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100034127 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100034127
NCBI-ProteinID: NP_001157434
Ensembl: ENSECAG00000000152
VGNC: 49477
UniProt: Q95MD2
LinkDB
Position
28
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICENRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVQHLSVSLTDLLEKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSS
ENVKKSYKSQESRLFTPEEFFRIFNRSIDAFKDLEMVVSKTSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNFTGDSNLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaaccaaaggaatctgtgaaaaccgtgtgactgatgatgtgaaagacgtg
acaaaattggtggcaaatcttccaaaagactataagataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtgcaacacttgtcagtcagc
ttgactgatctcttggagaagttttcaaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaatagtggatgatcttgtggagtgcatggaagaacactcatct
gagaatgtaaaaaaatcatataagagccaagaatccaggctatttactcctgaagaattc
tttagaatttttaatagatccatcgatgccttcaaggacttggagatggtggtatctaaa
actagtgaatgtgtggtgtcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaatttcactggagactccaacctacaatgggcagccatggca
ttgccagcattcttttctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaacgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system