KEGG   Equus caballus (horse): 100034189
Entry
100034189         CDS       T01058                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04810  Regulation of actin cytoskeleton
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100034189 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100034189 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100034189 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100034189 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100034189 (FN1)
   05205 Proteoglycans in cancer
    100034189 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100034189 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100034189 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100034189 (FN1)
   05100 Bacterial invasion of epithelial cells
    100034189 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100034189 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100034189 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100034189 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100034189 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100034189 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]
    100034189 (FN1)
Membrane trafficking [BR:ecb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100034189 (FN1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100034189 (FN1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100034189 (FN1)
Domain-containing proteins not elsewhere classified [BR:ecb04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   100034189 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 100034189
NCBI-ProteinID: XP_001489154
Ensembl: ENSECAG00000000701
LinkDB
Position
6
AA seq 2477 aa
MLRGPGPGLLLLVVLSLGTAVPSSGASKRKRQDQQIIQPQSPVAVGQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHASLQTTSTGSGPFTDVRTAIYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDSAVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRV
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNAPGRWKEATIP
GHLNSYTIKGLRPGVVYEGQLISVQHYGHKEVTRFDFTTTSTSPAVTSNTVTGETTPFSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELTLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTG
VPRADKVPPPRDLQFVEVTDVKITIMWTPPESAVTGYRVDVLPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYHFKIFAVNHGRESKPLTGEQTTKLDAPTNLRFINETESTVIVTWTPP
RARIAGYRLTVGLTRGGQPKQYNVGPSASQYPLRSLQPGSEYTVTLVAVKGNQQSPKATG
VFTTLQSPGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTSGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWAP
PPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHTGGRPREDRVPPS
RNSITLTNLNPGTEYVVSIVALNGREESPPLVGQQSTVSDVPRDLEVIATTPTSILISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGPGQSKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPRGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTELKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSTSVVVSGLMVATKYEVSVYALKDTLTSRPAQGIVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQPPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVIIDASTAIDAPSNLHFLATTPNSLLISWQPPRARITGYIIKYEKPGSPPREVVP
RPHPGVTEATITGLEPGTEYTIQVIAIKNNQKSEPLIGRRKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITNPGYDNGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPV
RHRPRPYPPNVNEEIQIGHVPRGDVDQHLYPHVLGLNPNTSTGQEALSQTTISWTPFQES
SEYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEALKDQKRHKVREEVVT
VGNSVDQGLGQPTADSCFDPYTVSHYAIGEEWERLSESGFKLSCQCLGFGSGHFRCDSSK
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGHEGSTGHSYNQYSQRYQQRTNTNVNCPI
ECFMPLDVQADRDDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgctcaggggtccgggacctgggctgctgctgctggtcgtcctgtccctggggacagcg
gtgccctccagcggagcctcgaagaggaagaggcaggatcagcaaatcattcagccccag
tccccggtggctgtcggccaaagcaagcctggttgttacgacaatgggaaacactatcag
ataaaccaacaatgggagcgcacctacctgggcaatgccttggtttgtacctgctacgga
gggagcagaggctttaactgcgagagtaaacctgagcctgaagagacttgctttgacaag
tacaccgggaacacttaccgggtcggcgacacttacgagcgccctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaatcagctgcaccattgcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagacctcatgagact
ggtggttacatgttagagtgtgtctgtcttggtaatgggaaaggagaatggacctgcaag
cctatagctgagaaatgttttgatcatgctgctgggacctcttatgttgtcggggaaacc
tgggagaagccctaccaaggctggatgatggtggactgtacttgtctgggagaaggcaat
gggcgcatcacctgtacttctagaaacagatgcaatgatcaggacactaggacatcctat
agaattggcgatacctggagcaagaaggataatcggggaaacctgctccagtgcatctgc
acaggcaacggcagaggggagtggaagtgtgaaaggcacgcgtctctgcagaccacatcc
accggatctggccccttcacagatgtccgaacagccatttaccagccccagcctcacccc
cagcccgctccatacggtcactgtgtcacagacagtggcgtggtttactccgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcacttgcctgggcaatggagtc
agctgccaagagacagctgtgacccagacttatggtggcaattcaaacggggagccgtgt
gtcttacccttcacctacaacggcagaaccttctactcctgcaccacggaggggcggcag
gatggacacctctggtgcagcacgacttccaattatgagcaagaccagaaatattctttc
tgtacagacagtgctgttttggttcagactcgaggtgggaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaactacactgactgtacttctgagggcaggaga
gacaacatgaaatggtgtggaaccacccagaactatgacgcggaccagaagtttggattc
tgccccatggctgcccacgaggaaatctgtacaactaatgaaggggtgatgtatcgcgtt
ggagatcagtgggataagcaacacgacatgggccacatgatgaggtgcacatgtgtcggc
aatggtcgtggggaatggacgtgtgtcgcctactcccagctccgagatcaatgcattgtc
gacgacatcacttataacgtgaatgacacatttcataagcgtcacgaagagggacacatg
ctgaactgtacctgcttcggtcagggccggggcagatggaagtgtgatcccattgaccaa
tgccaggactcggaaacccgaacgttttatcagattggagactcctgggagaaatatgtg
catggtgtcaggtaccagtgctattgctatggccgtggcattggggagtggcattgccaa
cctttgcagacctacccgggcaccactggtcctgtccaagtaatcatcacagagaccccc
agccagcccaactcacaccccatccagtggaacgcaccggagccatctcacatctctaag
tacatcctcagatggaaacccaaaaatgctccaggccgttggaaggaagccaccattcca
ggccacttgaactcgtacactatcaaaggcctgaggccaggtgtggtatatgagggacag
ctcatcagtgtccagcactacggccacaaagaggtgacacgctttgacttcaccaccacc
agcacaagcccagcagtgaccagcaacactgtgactggagagacaacaccgttttccccc
gttgtggccacttctgaatctgtgactgaaatcaccgccagcagcttcgtggtctcttgg
gtctcggcttcagacaccgtgtcaggattccgtgtggaatatgagctgagtgaggaggga
gatgaaccacagtacctcgatcttccaagcacggccacttctgtaaacatccctgacctg
cttcctggccgaaaatacatcgtaaatgtctatcagatttctgaagaaggagagcagagt
ctgatcctgtctacttcgcagacaacagcgcctgatgcccctcctgatcctactgtggac
caagttgatgacacctcgattgttgttcgctggagcagacctcaggcacccatcacagga
tacagaatcgtgtattcaccatcagtagaagggagtagcacagaactcacccttcctgaa
actgccaactccgtcaccctcagcgacttgcaacctggggttcagtataacatcaccatc
tatgctgtggaagagaatcaagaaagtactcctgttttcatccaacaggaaactactggc
gtcccacgtgcagataaagttccgcctccccgggacctgcagtttgtggaggtgacagac
gtgaagatcaccatcatgtggacaccccctgagagcgcggtgaccggctaccgtgtggac
gtgctccccgtcaacctgcctggggagcacggccagaggctgcccatcagcaggaacacg
tttgcagaagtcacagggctgtcccctggggtcacctatcacttcaaaatcttcgccgtg
aaccacgggagggaaagcaagcctctgacaggagaacagacaaccaaattggatgctccc
actaacctccggtttatcaatgaaactgagtcgactgtcatagtgacctggacaccccct
cgggcccggatagccgggtatcggctgaccgtgggcctgacccggggaggccagcccaag
cagtacaacgtggggccctctgcctctcagtacccactgaggagtctgcagcctgggtct
gagtacaccgtcaccctcgtggccgtcaaaggcaaccagcagagccccaaagccactgga
gtctttactactctgcagtctccaggctccattccaccttacaacacagaggtgactgag
accaccattgtgattacatggacgcctgctccaaggattggttttaagctgggtgtgcga
ccaagccagggaggggaagcaccgcgagaagtgacttcagactcaggaagcatcgttgtg
tctggcctgaccccaggcgtggaatacgtttacaccatctcagtcctgagagatgggcag
gagagagatgcgccaatcgtgaagaaagtggtgacaccattgtctcccccaacaaacttg
cacctggaggcaaaccccgacactggagtgcttacggtctcctgggagaggagcaccacc
ccagacattactggttatagaatcaccaccacgcctacaagtggccaacaaggctattct
ctggaagaagtggttcatgcagatcagagttcttgcacttttgaaaacctgagtcctggc
ctggagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtatcgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagttacagggctggagcctggcattgactatgacatcagcgttatcact
ctcattaatggcggagagagtgcccctactacgctgacacaacaaaccgccgtccctcct
cccactgacctgcgattcaccaatgttggtccagacactatgcgtgtcacctgggcccca
cctccatctattgaattgaccaacctcctggtgcgctactcacccgtgaaaaatgaggaa
gatgttgcggaattgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctgggacagaatacttagtcagtgtctccagcgtttacgaacaacacgagagcacacct
cttagaggaagacagaagacaggtcttgattccccaactggcattgacttttctgatatc
actgccaactctttcacggtccattggattgctcctcgagccaccatcactggctacagg
attcgccatcatcctgagcacactggtggaagaccacgagaggatcgagtgcctccctct
cggaattctatcaccctcaccaacctcaatccaggcacagaatatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcctcccttggttggccaacaatcaacagtttctgac
gttccaagggacctggaagttattgccacaacccccaccagcatcttgatcagctgggac
gctcctgccgtcacagtgagatattacaggatcacctatggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctggcagcaagtctacagctaccatcagtggccttaaa
cctggagtagactacaccatcaccgtttatgctgtcactggccgcggggacagcccagcc
agcagcaagccaatttccattgattaccgaacagaaattgacaaaccatcccagatgcaa
gtgactgatgttcaggacaacagcattagtgtcaggtggctgccttcaagttcccctgtt
actggctacagagtgaccactactcccaaaaatggcccaggacaatcaaaaactaaaact
gcaggtccagatcaaacagaaatgaccatcgaaggcttacaacccacagtggagtatgtg
gttagtgtctatgctcagaatcaaaacggagagagtcagcctctggttcagacagcagta
accaacattgatcgccctagaggactggcattcacagatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcaggccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagccattcctgcaccaactgaactcaag
ttcactcaggttacaccaacaagcctgaccgcccagtggacagcacccaatgttcagctc
actgggtaccgcgtgcgggtgacccccaaggaaaagactggaccaatgaaagaaattaac
cttgctcccgatagcacatctgtggtcgtatcaggactcatggtggccaccaagtatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccggctcagggaattgtcacg
accctggagaatgtcagccctccaagaagggcccgcgtgacagatgctactgagactacc
atcaccattagctggagaaccaagactgagaccatcactggcttccaggttgatgccgtc
ccagcaaatggccagcctccaatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttgcaacccggcactgactacaagatctacttgtacaccctgaatgacaat
gcccggagctcccctgtgatcatcgacgcctctactgccattgatgcaccatccaacctg
catttcctggccaccacgcccaactccttgctgatatcatggcagccaccccgtgccagg
attactggttacatcatcaagtatgagaagcctgggtcccctcccagagaagtggtccct
cggccccaccctggtgtcacagaggctactattactggtctggaaccaggaaccgagtac
actattcaagtcattgccatcaagaacaaccagaagagcgagcctctgatcgggaggaga
aagacagatgagcttccccaactggtaacccttccacaccccaatcttcacggaccagag
atcttggatgttccctccacagttcaaaagacccctttcatcaccaaccctgggtatgac
aatggaaacggtattcagcttcctggcacttctggtcagcagcccagtgttgggcaacaa
atgatctttgaggagcatggttttaggcgaaccacaccgcccacaacggccacccccgta
aggcataggccaagaccatatccgccgaatgtaaatgaggagatccaaattggtcatgtc
cccaggggagacgtagaccagcacctctaccctcacgttctgggactcaatccaaatacc
tctacaggacaagaggctctctctcagacaaccatctcttggaccccattccaggaaagc
tctgagtatatcatttcatgtcatccagttggcattgatgaagaacccttacagttccga
gttcctggaacctctgctagtgccaccctgacgggtcttaccagaggggccacctacaac
atcatagtggaggcactgaaagaccagaagaggcacaaggttcgggaggaggtcgttact
gtgggcaactctgttgaccaaggcctaggccaacctacggctgactcgtgcttcgacccc
tacaccgtctcccattacgccatcggagaggagtgggagcgactgtctgaatctggcttt
aaactctcctgccagtgcttagggtttggcagtggccatttcagatgcgattcgtctaag
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggatcgtcagggagaa
aatggccagatgatgagctgcacatgtcttggaaatggaaaaggagaattcaagtgtgac
cctcatgaagcaacatgttatgatgacgggaagacgtaccacgtaggagaacagtggcag
aaggagtatcttggtgctatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctggggctgaacccggtcacgaaggctccactgggcactcc
tacaaccagtattcacagagataccagcagagaaccaacaccaatgtcaactgcccaatt
gagtgcttcatgcctttagatgtacaggctgacagagatgattcccgagaataa

KEGG   Equus caballus (horse): 100037402
Entry
100037402         CDS       T01058                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04974  Protein digestion and absorption
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100037402 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100037402 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100037402 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100037402 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    100037402 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100037402 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100037402 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100037402 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100037402 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100037402 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100037402 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100037402 (COL4A3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100037402 (COL4A3)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100037402 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100037402
NCBI-ProteinID: XP_023498215
Ensembl: ENSECAG00000007376
LinkDB
Position
6
AA seq 1761 aa
MPRSEGHSLVSRKGGERGRDLSHFFPPLEPQSKASVGRARQRAEPYKTRPGPAGEASFPA
GLPNPRRAGDAVAGEPASPWTRRGSERAPTMRPRTAPRPPALLLPLVLALLAAAPAAGKG
CVCKGKGQCFCDGTKGEKGEKGFPGPPGSPGQKGFPGPEGLPGPEGPKGSPGLPGLTGPK
GVRGITGLPGFSGPPGLPGTPGHPGPYGLAGLPGCNGSKGEQGFPGLPGTPGYPGIPGAV
GLKGEKGAPAEGEGIELDRKGDPGLPGTPGFQGLPGLPGFPGPAGPPGPPGFFGFPGIMG
PPGPKGHMGDNVIGQKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGTMGKS
GPPGLSGPPGESYGSEKGAPGEPGPQGKPGKEGAPGFPGTQGAKGNRGFPGLTGEDGIKG
WKGDIGPPGFRGPTEYYDAYQEKGDEGIPGPPGPKGARGPQGPSGPPGVPGSPGSSRPGL
RGVPGSPGMKGSKGEQGPPGKDAVGPPGSPGCPGSPGPPGSPGPPGPPGEIIFRKGPPGD
GGLPGHVGSPGIPGVYGPKGEPGFLCTQCPYVPGPPGLPGLPGLDGVKGIPGGRGAAGIK
GSTGSPGSVGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGAPGDPGLRGHPGRKGLDGI
PGTPGVKGLPGPKGELALSGEKGAQGPPGDPGTPGSPGPVGPAGPSDYGLHGEPGPKGTQ
GVPGAPGPPGEAGPKGEFNVLTPVPGPPGFPGPPGRAGPRGPPGIPGSIGKCGDPGIPGP
DGEPGIPGIGFPGPPGPKGDRGFPGTKGSPGCPGEMGKPGLPGQPGLPGAKGEPGPAMPG
EPGIPGFPGERGISGENGEIGHPGLPGLPGFPGTGGLDGPRGDPGQSGPPGERGLPGRCT
EGPRGAQGLPGLNGLKGQQGRRGETGPKGDPGIPGLDRSGFPGEPGPPGIPGHRGVTGPP
GQKGYPGNPGFLGPPGEKGAVGMMGSPGFTGPPGPPGKPGTPGQRGSSGIPGVKGERGPP
GAKGDEGDKGASGSSQISHVLGDKGEPGLKGFAGRPGEKGSKGIPGLPGLKGLEGPPGPS
GPPGPRGDPGSTGHPGEPGPRGVPGSMGNLGVPGSKGTRGTLGLPGPPGRPGLPGIHGLP
GDKGEPGYSEGTRPGPPGPKGDPGLPGDTGKKGERGPPGAPGYLGPAGPDGVPGHPGSPG
LPGKPGPDGDLGFKGIKGFPGSPGIKGPPGPPGFPGNPGPTGVRGEQGRDGIPGPAGEKG
ETGLLGALPGPRGNPGPRGAKGDRGAPGLPGLPGRKGTVGDVGPQGPIGMTGPPGPPGFP
GAVIPGQKGNQGPPGFQGNPGEPGPPGPPGSHTEGIKGDKGFMGRPGSRGPPGTVGDMGP
PGHPGPPGTPGHPGLQGDPGFHGFPGMRGEKGNPGFLGSIGPPGRPGPKGPPGAHGDPGT
VQIISLPGSPGPPGPVGEPGMQGEPGPLGPPGKPGPCGPRGKPGKDGKPGTPGPPGEKGD
KGCKGEPGPPGADGPPGLKGKPGFSGAPATGAAMRGFIFTRHSQTTAIPSCPEGTEPLYS
GFSLLFIQGNEQAHGQDLGALGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALM
PMDMAPITGRALEPYISRCTVCEGPAIAIAIHSQTTDIPPCPHGWISLWKGFSFIMFTSA
GSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPARMFRKPIPST
VKAGELEKIISRCQVCMKRRL
NT seq 5286 nt   +upstreamnt  +downstreamnt
atgcccaggtcagagggacatagcctggtgagtcggaagggaggggaacgagggcgggac
ctgagccacttcttccctcccttggagccacagtcaaaagcctctgtggggagggccaga
cagcgggctgagccctacaaaacccgccccggaccggctggcgaggcgagcttcccagcc
gggctccccaacccgcgtcgcgcaggggacgcggtggccggagagcctgcgagtccctgg
acccgccggggctctgagcgggcgcccaccatgcgcccccggacggcgccaagaccgcct
gcgctgctgctgccgctcgtgctggcgctcctggcggcggcgcccgcagcgggcaagggc
tgtgtctgtaaaggtaaaggccagtgcttctgcgatgggaccaaaggggagaagggggag
aaaggttttcccggaccccctggctctcctggccagaaaggattcccaggtcctgaaggc
ctgcctggaccagagggacccaagggttcaccaggccttccaggactcactggtcccaaa
ggagtcaggggaataactggattgccaggattttcaggtcctcctggacttccaggcacc
ccaggccatcctggaccttatggacttgctggtttgccaggatgcaatggttctaagggt
gagcaagggtttccaggacttccggggacaccaggctacccagggatcccgggtgctgtc
ggtttgaaaggagaaaagggtgctcctgctgaaggggaagggatagaacttgaccggaaa
ggtgaccccgggttgccaggaactccaggattccagggtttgccaggccttccaggtttt
cccggacctgccggcccacctggccctccaggattctttggctttccaggaatcatggga
cctccaggacctaagggccacatgggcgacaatgtgataggacaaaaaggagaacggggt
gtgaaaggattaacaggaccccccggaccaccaggaacagtaattgtgacgctcaccggc
ccggataacagaacggacctcaagggcgagaaaggggacaagggaaccatgggaaaatcc
ggacctcctggactctcaggaccacctggagaatcttatggatctgaaaaaggtgctccc
ggagaacctggtccacagggaaaaccaggaaaagaaggtgctcctgggttccctggcact
cagggagccaaaggcaacagaggcttccctgggttaactggtgaagacggcattaagggg
tggaaaggggacattggccctccaggatttcgtggtccaacagaatattacgatgcttac
caggaaaagggagatgaaggaattccaggcccaccagggcccaaaggagctcgtggccca
cagggtcccagtggtccccccggagttcctggaagtcccgggtcatcaaggcctggcctc
agaggagtgcctggatcaccaggcatgaaaggaagtaaaggtgaacaaggacccccagga
aaggatgcagtggggccgcctgggtccccaggttgtcctggttcaccaggccctccaggg
tcaccgggacctccaggaccaccaggtgaaatcatttttcgcaaaggtccacctggagat
ggtgggcttccaggccatgtagggtctccaggaatcccaggagtctatgggcccaaaggg
gaaccaggcttcttgtgcacacagtgcccttatgtcccagggcctccgggtctcccagga
ttgccggggttagatggtgtaaaaggaatcccaggaggacgaggagcagctggcattaaa
ggaagcacggggtccccaggaagtgtgggtcttccaggatttccgggattcccaggtgct
cagggtgacccaggactcaaaggagaaaaaggcgaaactctgcagccagaaggacaagtg
ggtgccccaggggatcctgggctccgagggcatcctggaagaaagggcttggatggaatt
cctggaactccaggagtcaaaggattaccaggacctaaaggcgaactggccctgagtggt
gagaagggggcccagggtcctccaggggatcctggcacccctgggtctccaggacctgta
ggaccggctggaccatcagactatggactacacggagagcctggtccaaagggcacccaa
ggagttcctggagcccctggaccacctggagaagccggtcctaagggagaattcaatgtt
ttgacaccagtcccaggccccccaggatttccagggcccccaggccgtgctgggccccga
ggcccacctggtatccctggatccataggaaaatgtggtgatccaggtattcctgggcct
gatggtgaaccaggaattccaggaattggatttcctgggcctcctggacctaagggagac
cgaggttttccaggaacaaaaggatcaccaggttgccctggagaaatgggaaagccaggg
ttacccggacagccaggcctcccaggagccaagggagaaccaggaccagccatgcctggg
gaaccaggaataccaggttttccaggagaaagaggcatttctggggaaaatggagaaatt
ggacaccctggacttccaggtctccctggatttccaggaactggagggcttgatggacca
cgaggggatccagggcagtctggaccacccggagaaagaggactcccaggaaggtgcaca
gagggtcccaggggagcccaaggacttccaggcttaaatggattaaaagggcaacaaggc
agaagaggcgaaacagggccaaagggagacccaggtattccaggtttggataggtcagga
tttcctggagaacctggaccaccaggaataccaggtcatcgaggtgtgacgggaccacct
ggtcaaaaaggatatccaggaaatccaggatttttagggccaccaggtgaaaaaggagcg
gttgggatgatgggctctcctggattcactgggcctccggggcctcctggaaagccaggc
accccaggacagaggggcagctctggaattccaggagtaaagggcgagagagggccccca
ggagccaagggggacgaaggggacaagggagcctcagggtcttctcaaatatcccatgta
ctgggggacaaaggagaaccaggcctcaaaggatttgcaggaaggcctggtgagaaggga
agcaaaggcatcccagggttaccaggtttaaaaggactcgaagggccacctggaccatca
ggaccaccaggccccagaggagatccgggcagcactgggcatcctggagaaccaggacct
cgtggtgtgccaggaagcatggggaacctgggggtaccaggttctaaaggaacaagggga
actttgggactcccaggtccacccggaagaccaggcctcccaggtattcatggtctccca
ggagacaagggagagccaggttactcagaaggtacaaggccaggaccaccaggaccaaag
ggagatccaggattgccaggtgacacgggaaagaaaggagaaagagggccacctggtgca
cctggatatttggggcctgctggacctgacggagtccctggacatcccggaagtcctggc
ctcccaggaaagccaggtcctgatggtgatttgggatttaaaggaatcaaaggcttcccc
ggctctccaggaataaaagggcctccaggccctccaggattcccaggaaatcctggacca
acgggtgtgaggggggagcaaggacgtgatggaattcctggtccagctggagaaaaggga
gaaacggggttgctgggggcacttccaggcccaagagggaaccctggtcctcgaggggcc
aaaggagacaggggagctccaggcttgcccggtctccctggcagaaaagggacagtggga
gatgtcgggccgcaaggtcccattggcatgacaggacccccagggcccccaggttttcct
ggtgcagtcatcccaggccaaaaaggaaatcaaggtccaccaggcttccaaggaaaccca
ggtgagcctggtccccctggacctccggggagtcacacagaaggcataaaaggagacaag
ggatttatgggcaggcctggctcaagaggtccgcctggaactgtaggagacatggggcca
ccgggtcatccgggaccaccaggtaccccaggtcacccagggctccaaggcgatcctgga
ttccacggatttccaggcatgagaggtgagaagggtaatccaggatttctgggatcaatt
gggcctccagggcgacctgggccaaaaggaccacccggtgcacatggagaccctggcaca
gttcagatcatctcccttccaggaagcccagggccacctggcccagttggagaaccagga
atgcaaggagaacctgggcccctggggccaccgggaaagccaggaccctgtgggccaaga
ggtaaaccaggcaaggatggaaaaccaggaactcctggaccacctggagaaaaaggtgac
aaaggttgtaaaggagagccaggaccacccggggcagacggaccgccaggtttgaagggg
aaacctgggttctctggagcacctgccaccggagcagcaatgagaggcttcatcttcacc
cggcatagtcagaccaccgcgattccttcctgtccggaagggacggagccgctctatagt
gggttttctcttctctttatacaaggaaatgaacaagcccatggacaagacctgggagct
cttggcagctgcctgcagcgatttaccacaatgccattcttattctgtaacatcaacaat
gtatgtaatttcgcatcgcgaaacgattattcatactggctgtcaacaccagcactgatg
ccaatggacatggctccaattactggcagggccctggagccttatattagcaggtgcact
gtctgtgaaggtcctgcgattgccatagccattcacagccaaaccactgacattccccca
tgtccccatggctggatttctctctggaaaggattttctttcatcatgtttacaagtgca
ggttctgagggcgctgggcaagcactggcatctcccggatcctgcctggaggaattccga
gccagtccatttatagaatgtcacggaagaggaacgtgcaactactattcaaattcctac
agtttctggttggcttcattaaatccagcaagaatgttcagaaaacctattccatcaact
gtgaaagctggggagttagaaaagataataagtcgctgtcaagtgtgcatgaagagaaga
ctttga

KEGG   Equus caballus (horse): 100053539
Entry
100053539         CDS       T01058                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100053539 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100053539 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100053539 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100053539 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100053539 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100053539 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100053539 (LAMB2)
   05145 Toxoplasmosis
    100053539 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 100053539
NCBI-ProteinID: XP_001498255
Ensembl: ENSECAG00000021805
VGNC: 19566
UniProt: F7BK38
LinkDB
Position
16
AA seq 1836 aa
MLPNFALSRWTLLVEGPPNGQRAEWGISQEPTRAGMERASGERGRDWRGQPAPWELRLGL
LLSVLATALAQALAPDVPGCSRGSCYPATGDLLVGRADRLTASSTCGLHGPQPYCIVSHL
QDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRAAWWQSENGVPVVTIQLDLEAE
FHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVC
ESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLLKITNLRVNLTRLHTLGDNLLDP
RREIREKYYYALYELVVRGNCFCYGHASQCAPAPGAPAHAEGMVHGACICKHNTRGLNCE
QCQDFYHDLPWHPAEDGHSHACRKCECHGHAHSCHFDMAIYLASGNVSGGVCDGCQHNTA
GHHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDGGRCDPHDDPPLGLVSGQCRCKE
HVVGSRCQQCRDGFFGLSASDPVGCRRCQCDARGTVPGGTPCDPNSGTCFCKRLVTGHGC
NRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCNEATGQCRCRQHMVGRRCEQVQPGYFRP
FLDHLTWEAEDVQGQVLDVVERLVIPGGAPSWTGLGFVRLREGQALEFLVASVPRAMDYD
LLLRLEPQVPEQWAEMELTVQRPGPVSAHSLCGHVLPKDDYIPGTLQSDTRYMVLPRPVC
LEPGNSYKLHLKLVRTGGSAQPDAPYSGPSLLIDSLVLLPRVLVLEMFSAGDAAALERRA
TFERYRCHEEGLLPSKTLPSEACAPLLISLSTLLYNGALPCQCDPQGSLSSECNPHGGQC
LCKPAVVGRRCDLCAPGYYGFGPTGCQACQCSPEGALSSLCEGTSGQCPCRPGAFGLRCD
RCQRGQWGFPSCQPCVCNGHADECDTHTGTCLGCRDHTGGEHCERCIAGFYGDPRLPYGG
QCRPCPCPEGPGSRQHFATSCHQDGYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPGGR
CQPCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNL
LGTDPQQCPSTDRCNCDPSSGQCPCLPNVQGPSCDRCAPNFWNLASGHGCQPCACHPSRA
RGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCRACDCDPRGIDTPQCHRSTGHC
SCRPGMSGVRCDQCARGFSGVFPACHPCHACFGDWDRVVQDLAARTRRLEQRAQELQQTG
VLGAFERSFWHMQEKLGTVQGIVGARNTSAASTAQFLEATEELRREIGEATEHLTQLEAE
LTDVQDENFNANHALSSLERDGLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSLSAE
AERRANTSALTVPSPVSNSAGIRHRTEVLMGAQREDFNRKYMANQQALGKLSARTHTLSL
TNINELVCGPPGDAPCATSPCGGAGCRDEDGQPRCGGLSCNGAAAMADLALGRARHTQAE
LQRALAEGGGILSQVAETRRQAGEAQQQAQAALDKANASRGQVEQANQELRELIQSVKDF
LSQEGADPDSIEMVATRVLELSIPASPEQIQHLAGAIAERVRSLADVDTILARTVGDVRR
AEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGAAQGAIQGAVVDTQDTEQTLHQV
QERMAGAEQALSSAGERAQQLDGLLEALKLKRAGNSLAASSAEETAGSAQGRAREAEQLL
QGPLGDQYQTVRALAERKAQGVLAAQARAEQLRDEARGLLQAAQDKLQRLQELEGTYEEN
ERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5511 nt   +upstreamnt  +downstreamnt
atgcttcccaactttgctctaagtcgctggactctgctagtggagggaccgcccaacgga
cagagggcagagtggggaatcagccaagaacccacacgggcagggatggagcgggcctca
ggggaacgagggagggactggcggggacagcctgcgccctgggagctacgactgggcctg
ctgctgagcgtgctggccaccgccctggcccaggctctggccccggatgtgccaggctgt
tcgcggggaagctgctaccccgccacaggtgacctgctggtgggccgagctgacagactg
accgcctcatccacctgtggtttgcatggcccccagccctactgcatcgtcagtcacctg
caggacgaaaagaagtgctttctgtgtgattcccggcgccccttctctgctcgagacaac
ccaaacagccatcgcatccagaatgtagttaccagcttcgcaccacagcgcagagcagcc
tggtggcagtcagagaatggtgtccccgtggtcaccatccagctggacttggaggctgag
ttccatttcacgcacctcattatgactttcaagacatttcggcctgctgccatgctggtg
gagcgctcagcagactttggacgcacctggcatgtgtaccgatatttctcctatgactgt
ggggctgacttcccaggagttccactggcccccccacggcactgggatgacgtagtttgt
gagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgtgtgctg
gaccctgccatccctatcccagacccctacagttcacggatccagaacctgctgaagatc
accaacctacgggtgaacctgacacggctacacacgctgggggacaacctgcttgaccca
cgacgggagatccgtgagaagtactattatgccctctacgagctggttgtgcgtggcaac
tgcttctgctacggacatgcctcacagtgtgcacccgccccaggagcaccagcgcacgct
gagggcatggttcatggggcctgcatctgcaaacacaacactcgtggcctcaactgtgag
cagtgtcaggatttctatcatgatttgccctggcatccagccgaggatggccacagtcat
gcctgcagaaagtgtgagtgccatgggcatgcccacagctgccacttcgacatggccata
tacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcacaacacagct
gggcaccactgtgagctctgccgacccttcttctaccgtgacccaaccaaggatctgcgg
gacccggccgtgtgccgctcttgtgattgtgaccccatgggttcccaagacggtggtcgc
tgtgatccccatgatgatcctccactggggctggtttcgggccagtgtcgctgcaaagaa
catgtggtgggctctcgctgtcaacaatgccgtgatggcttctttgggctcagtgccagt
gaccctgtaggctgccggcggtgtcagtgtgatgcacggggtacagtgcctgggggcacc
ccttgtgaccccaacagtggaacctgtttctgcaagcgtctagtgactggacatggctgt
aaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgtccgtgt
gactgcgacgtgggtggtgccttggatccccagtgcaatgaggcaacaggtcagtgccgc
tgccgccagcacatggtagggcgacgctgtgagcaggtgcagcctggctacttccggccc
ttccttgaccacctaacttgggaggctgaggatgttcaagggcaggtgcttgatgtggtg
gagcgcctggtgatccctgggggagctccatcttggacaggcctgggctttgttaggctg
cgggaaggccaagcactggagttcctggtggcctctgtgccaagagccatggactacgac
ctgctgctgcgcttggagccccaggtccctgagcaatgggcagagatggaactgactgtg
cagcgcccagggcctgtgtctgcccacagcctgtgtgggcatgtgctgcccaaggatgac
tacatccctgggaccctgcaatcagacaccaggtacatggtgcttcccagacctgtctgc
cttgagcctggcaactcctacaagctgcatctgaagctggtgcgaacaggaggaagtgcc
cagcctgatgccccctactctggacccagcctgctcattgactcgctggtgctgctgccc
cgtgttcttgtgctggagatgtttagtgcgggtgatgctgctgccctagagcgccgtgcc
acctttgaacgctaccgctgccatgaggagggtctgctgcccagcaagactcttccctct
gaggcctgtgctccgctcctcatcagcctgtccaccctgctctacaacggtgctctgccc
tgtcagtgtgacccccagggctcactgagttctgagtgcaacccccatggtggccagtgc
ctgtgcaaacctgcagtggttgggcgccgctgtgacctctgtgcccctggctactatggc
tttggccccacaggctgtcaagcctgccaatgcagccctgaaggggcgctcagcagcctg
tgtgaagggaccagtgggcaatgcccctgccgacctggtgcctttgggcttcgctgcgac
cgctgccagcgtggccagtggggattccctagctgccagccatgtgtctgtaatgggcat
gcagacgaatgtgacacccacacaggcacttgcctaggctgccgtgatcacacagggggt
gagcactgtgaaaggtgtattgctggcttctatggggaccctcggctgccatatgggggc
cagtgccggccctgtccctgccctgaaggccccgggagccggcagcactttgccacttct
tgccatcaggacgggtactcccagcagatcgtgtgccactgcagggcaggctacacaggg
ctacggtgtgaagcttgtgcccctggccactttggggacccatcaaggccaggtggccgg
tgccaaccatgtgagtgcagtgggaacattgaccccatggaccctgatgcctgtgacccc
cacacggggcaatgcctgcgctgcttacaccacacagaggggccacactgtgcccattgc
aagcctggcttccatgggcaggctgcccggcagagctgtcaccgctgtacctgcaacctg
ctgggcacagatccccaacagtgcccatccactgaccgatgcaactgtgacccaagcagt
gggcagtgcccttgcctccccaatgtccagggccctagctgtgaccgctgtgcccccaac
ttctggaaccttgccagtggccatggctgccagccctgtgcctgccacccaagccgagcc
agaggccccacctgcaatgagttcacagggcagtgccactgccgtgctggctttggtggg
cgaacctgttctgagtgccaagagctccactggggagaccctgggttgcagtgccgtgcc
tgtgattgtgaccctcgtggaatagacacacctcagtgtcaccgctccacaggtcactgt
agctgccgcccaggcatgtctggtgtgcgctgtgaccagtgtgcccgtggcttctcaggt
gtctttcctgcctgccacccctgccatgcatgcttcggggactgggaccgtgtggtacag
gacttggctgcccgtacacggcgcctggagcagcgggcacaggagctgcagcagacgggt
gtgctgggtgcctttgagagaagcttctggcacatgcaagagaagctgggcactgtgcag
gggattgtgggtgcccgcaacacctcggctgcctccactgcgcagtttctggaggccaca
gaggagttgcggcgtgaaattggggaggccactgagcacctgacccagctggaggcagag
ctaacagatgtgcaggatgagaacttcaatgccaaccatgcactaagcagtctggagaga
gatgggcttgcacttaatcttacactgcggcagctggatcagcatctggacctgctcaaa
cattcaaacttcctgggtgcctatgacagcatccgccatgcccacagcctgtctgcagag
gcagaacgtcgtgccaacacatcggccctgacagtgcccagccccgtgagcaactcagca
ggcattcggcacaggacagaagtgctgatgggtgcccagagagaggacttcaaccgcaaa
tacatggccaaccagcaggcattgggcaagctctctgcccgtacccacaccctgagcctg
acaaacatcaatgaactggtatgtgggcccccaggggatgcaccctgtgctacaagccct
tgtgggggtgccggctgtcgggacgaggatgggcagccccgctgcgggggcctcagctgc
aacggggcagccgccatggcagacctggcactgggtcgggcccggcacacacaggcagag
ctgcagcgggcactggcagaaggtggtggcatcctcagccaggtggctgagacccgtcgg
caggcaggcgaggcacagcagcaggcccaggcggccctggataaggctaatgcttccagg
ggacaggtggagcaggccaaccaggaactgcgggaacttatccagagtgtgaaggacttc
ctcagccaggagggggctgatcccgatagcattgagatggtggccacaagagtactagag
ctctccatcccagcatcacctgagcagatccagcacctggcaggcgcaattgcagagcgg
gtccggagtctggcagatgtggacacgatcttggcgcgtactgtgggagatgtgcgtcgg
gcagagcagctactgcaggatgcacgtcgggcacggagccgggctgagggtgagaaacag
aaggcagagacagtacaggcggcactggaagaggcccagcgggcacaaggtgctgctcag
ggtgccatccagggggcagtggttgacacacaggacacggagcagaccctgcaccaggta
caggagaggatggcaggtgcagagcaggcactgagttctgcaggtgagcgggctcagcaa
ttggatggtcttttggaggctctcaaattgaaacgagcagggaatagcctggcagcctct
agcgctgaagagacagcaggcagtgcccagggtcgtgcccgagaggctgagcagctgctg
cagggtccactaggcgaccagtatcagacagtgagggccctggctgagcgcaaggcccag
ggtgtgctggctgcgcaggcgcgggcagagcaactgagggatgaggctcggggcttgttg
caggccgctcaggacaaactgcagcggctgcaagagctggagggcacttatgaggagaat
gagcgggcgctggagggcaaagcggcccagctggatggactggaggccagaatgcgcagc
gtgcttcaagccatcaacttgcaagtccagatctacaacacctgccagtga

KEGG   Equus caballus (horse): 100054545
Entry
100054545         CDS       T01058                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain isoform X5
  KO
K06237  collagen type IV alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04974  Protein digestion and absorption
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100054545 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100054545 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100054545 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100054545 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    100054545 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054545 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100054545 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100054545 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100054545 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100054545 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100054545 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100054545 (COL4A5)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100054545 (COL4A5)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100054545 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100054545
NCBI-ProteinID: XP_001490469
Ensembl: ENSECAG00000000668
VGNC: 16742
UniProt: F7C5C2
LinkDB
Position
X
AA seq 1685 aa
MKLRGVSLAAGLFLLALSLWGQPAEAVACYGCSPGSKCDCSGVKGEKGERGFPGLKGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGDPGYPGPPG
IQGLAGPTGIPGPIGRPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIPGPPGPPGGVKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDVGPTGPPGRVIPRPGTGVTVGEKGS
IGLPGLPGEKGERGFPGIQGPPGLPGPPGTAVMGPPGPPGFPGERGQKGDEGPPGTSIPG
PPGLDGQPGAPGLPGPPGPPGPHIPPSDEICEAGPPGPPGSPGDRGLPGEQGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGHAGATGPKGLTGMPGAPGAPGF
PGSKGEPGDILTFPGMKGDKGELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGIAFKG
ERGPPGNPGLPGLPGSRGPMGPPGFGPPGPVGEKGIQGVAGNPGQPGLPGPKGDPGQTIT
QPGKPGLPGNPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGLPGPPGPKGFPGI
PGPPGAPGAPGRIGLEGPSGPPGFPGPKGEPGFGLPGPPGPPGLPGFRGTLGPKGDRGFP
GPQGPPGRTGLDGLPGPKGDIGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG
IPGEKGDPGPPGFDVPGPPGERGSPGLPGAPGPMGPPGSPGLPGKAGASGFPGAKGEMGM
MGPPGPPGPLGIPGRSGVPGLKGDDGLQGQPGPPGPAGVKGGKGEPGLPGPPGPMDPDLL
GLKGEKGDPGLPGIPGISGPKGYQGLPGDPGQPGLSGQPGLPGPSGPKGNPGPPGTPGLT
GPPGLKGNIGDMGFPGPQGVKGSPGSPGIPGQPGTPGLPGQKGEKGDPGVSGIGLPGLPG
PKGEPGLPGYPGNPGIKGSLGDTGLPGLPGTPGAKGQPGLPGFPGTPGLPGPKGINGPPG
NPGLPGEPGPVGGGGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDEGLPGIPGNPGLPGPKGEPGFQGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGLPGPEGPRGLPGNGGVKGERGNPGQPGQPGLPGLKGDQGPPGPQGNPGRPGLNGMK
GDPGLPGVPGFPGMKGPSGIPGLTGPEGDPGLIGPPGPPGLPGPSGQSIIIKGDAGPPGV
PGQPGLKGLPGLPGPQGLPGPIGPPGEPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGP
PGPDGLQGPPGPPGTSSIAHGFLITRHSQTTDAPQCPQGTVQIYEGFSLLYVQGNKRAHG
QDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMEPLKGQSIQPF
ISRCAVCEAPAVVIAVHSQTIQIPRCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSC
LEEFRSAPFIECHGRGTCNYYANSYSFWLATVDMSDMFSKPQSETLKAGDLRTRISRCQV
CMKRT
NT seq 5058 nt   +upstreamnt  +downstreamnt
atgaaactgcgtggagtcagcctggctgccggcttgttcttactggccctgagtctttgg
gggcagcctgcagaggctgtggcgtgctatggatgttctccaggatcaaagtgtgactgt
agtggtgtaaaaggagaaaagggggagagaggatttccaggtttgaaaggccatccaggt
ttgcctggatttccaggtccagaagggcctccagggcctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaagggatcagaggtcctcctggacttcctggattt
ccagggacaccaggtcttcctggaatgccaggccatgatggggccccaggacctcaaggt
atccccggatgcaatggaaccaagggagaacgtggatttccaggcagtcccggttttcct
ggtttacagggtcctccaggaccgcctgggatcccaggtatgaagggagaaccaggtagt
ataattatgtcatcactgccaggaccaaagggtgacccaggatatccaggtcctcctgga
atacaaggcctagctggtcccactggtataccaggaccaattggtcgcccaggaccacca
ggtttgatgggtcctcctggtcccccaggactgccaggaccaaagggtaatatgggctta
aatttccagggacccaagggtgaaaagggtgagcaaggtcttcagggcccccctgggcca
cctgggcagatcagtgaacagaaaagaccaattgatgtagagtttcagaaaggagatcag
ggacttcctggtgaccgagggcctcctggacctccagggatacctggtcctccaggtcct
ccaggtggtgtgaaaggtgagaagggtgaacaaggagagcctggcaaaagaggtaaaccg
ggcaaagatggagagaatggccaaccaggaattccaggtttgcctggtgatcctggttac
cctggtgaacctggaagggatggagaaaagggccaaaaaggtgacgttggcccaactgga
cctcctggacgtgtaattcctaggcctgggactggtgtaactgtaggagaaaaaggaagc
attggattacctggtttgcctggagaaaaaggagagcgaggatttcctggaatacagggt
ccacctggtcttcctggacctccagggactgcagttatgggtcctcctggcccccctggc
tttcctggagaaaggggccagaaaggtgatgaagggccacccggaacttccattcctgga
cctcctggacttgatggacagcctggggctcctggccttccaggtcctcctggccctcct
ggccctcacatccctcctagtgatgagatatgtgaagcaggccctccgggccctccagga
tctccaggtgatagaggactcccgggagaacaaggagtgaaaggtgacaagggtgacacc
tgcttcaactgtattggaactggtatttcagggcctccaggtcagcctggtttgccaggt
cttccaggtcctccaggatctcttggtttccctgggcagaagggtgaaaaaggacatgct
ggtgcaaccggtcccaaaggattaacaggcatgccaggagctccaggtgctccaggcttt
cctggatctaaaggtgaacctggtgacatcctcacttttccaggaatgaagggtgacaaa
ggagagttgggttcccctggagctccggggcttcctggtttaccaggcacccctggacag
gatggattgccagggcttcctggccccaaaggagaacctggtggaattgcttttaagggt
gaaagaggtcctcctgggaacccaggtttgccaggtctcccagggagtagagggcctatg
ggccctcctggttttggccctccaggcccagtaggtgaaaaaggcatacaaggtgtggca
ggaaatccaggccagccaggattaccaggtcctaaaggtgatccaggtcagaccataacc
cagcccgggaagcctggtctgcctggtaatccaggcagggatggtgaagtaggtcttcca
ggtgaccctggactcccaggccagccaggcttgccaggaatacccggtagcaaaggggaa
ccaggtatccctggaattgggcttcctggaccacccggtcccaaaggttttcctggaatt
ccaggacctccaggagcacctggggcacctggaagaattggtctagaaggcccttctggg
ccaccaggctttccaggaccaaagggagaaccaggatttgggctacctgggccacctggg
cctccaggactcccaggttttagaggaacacttggtccaaaaggggatcgtggttttcca
ggacctcaaggtcctccaggacgcactggcttggatgggctgcctggaccaaaaggtgac
attggaccaaatggacaacctgggccaatgggacctcctgggctaccaggaataggtgtt
cagggaccaccagggccaccggggattcctggaccaataggccaacctggcttgcatgga
ataccaggagagaagggagatccagggcctcctggatttgatgttccaggaccccctggt
gagagaggcagtccaggactccccggagcgcctggtcctatgggacccccaggatcacca
gggctcccaggaaaagcaggtgcctctggctttccaggtgccaaaggtgaaatgggtatg
atgggacctccaggcccaccaggacctttgggaattcctggcaggagtggtgttcctggt
ctcaaaggtgatgacggtttacagggtcagccaggacctcctggccctgcaggagtgaaa
ggtggtaaaggagagcctggccttccaggccctcctggaccaatggatccagatctgctg
ggcttaaaaggagagaagggggaccctggcttaccaggtattcctggaatttcagggcca
aaaggttaccagggtctgcctggagacccagggcaacctggactgagtggacaacctgga
ttaccaggaccatcaggccccaagggtaaccctggtccccctgggacgccaggacttaca
ggacctcctggacttaaaggaaacataggtgatatgggttttccaggccctcagggtgtg
aaagggtctcctggatctcctggaattcctggacaacctggcaccccaggattacctgga
cagaaaggagaaaaaggtgatcctggtgtttcaggcattggtcttcccggtcttcctggc
ccaaagggtgaacctggtctgcctggatacccaggtaaccctggtatcaaaggttctctg
ggagatactggtttgcccggattaccagggacccctggagcaaaaggacaaccaggcctt
cctggattccctggaaccccaggccttcctggaccaaaaggtattaatggtcctcctggg
aaccctggccttccaggagaacctggtcctgtaggtggtggaggtcgtccggggccacca
gggcctccaggtgaaaaaggcaaaccaggtcaagatggtattcctggaccagctggacag
aagggtgaaccaggtcaaccaggctttggaatcccaggaccccctggactcccaggactt
tctggtcaaaagggtgatgaaggattgcctggcattccaggaaaccctggacttccaggt
ccaaagggcgaaccaggctttcagggtttccctggtgttcagggtcccccaggccctcct
ggttctccaggtccagctctggaaggccctaaaggcaaccctgggccccagggtcctcct
ggaagaccaggtctaccaggtccagaaggtccccgtggtctccctggaaatggaggtgtt
aaaggagagagaggaaacccaggccaacctgggcaacctggtttgcctggtttgaaagga
gatcaaggaccaccaggaccccagggtaatcctggccggccaggtctcaatggaatgaaa
ggagatcctggtctccctggtgttccaggatttccaggcatgaaaggacccagtggaata
cctggtttaactggccctgagggggatccaggacttattggccccccaggtcctcctgga
ttacctggtccttcaggacagagtattataatcaaaggagatgctggtccaccaggggtc
ccaggccagcctggattaaaaggtctaccaggactaccaggacctcaaggcttaccaggt
ccaattggccctccaggagagcctggacgcaatggactccctggctttgatggtgcagga
gggcgcaaaggagacccaggtctgccaggccagccaggtactcgcggtttggatggtccc
cctgggccagatggattgcaaggccccccaggtcctcctggaacctcctctattgcccat
ggattcctcatcacacgtcacagccagacaacagatgcaccacaatgcccgcagggtact
gtccagatatatgaaggcttttctctcctgtatgtacaaggaaataaaagagctcacggt
caagacttggggacggctggcagctgccttcgtcgcttcagtaccatgccttttatgttc
tgcaacatcaataatgtttgcaactttgcttcaagaaatgattattcttactggctctct
accccagaacccatgccaatgagcatggagcccctgaagggccagagcattcagccattc
attagtcgatgtgcagtatgtgaagctccagctgtggtcattgcagttcacagtcagacc
atccagattccccgttgtcctcagggatgggattctctctggattggttattccttcatg
atgcatacaagtgcaggagcagagggctcgggtcaagccctggcctcccctggttcctgc
ttggaggagtttcgttcagctccttttatcgaatgtcatgggcgaggtacctgcaactac
tatgccaactcctacagcttttggctggcgactgtagatatgtcagacatgttcagcaaa
cctcagtcggaaacgctgaaagcaggagacttgaggacacgtattagccgatgtcaagtg
tgcatgaagaggacataa

KEGG   Equus caballus (horse): 100055269
Entry
100055269         CDS       T01058                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05020  Prion disease
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100055269 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100055269 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100055269 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055269 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100055269 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100055269 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100055269 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100055269 (LAMC1)
   05145 Toxoplasmosis
    100055269 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 100055269
NCBI-ProteinID: XP_023496461
Ensembl: ENSECAG00000023141
VGNC: 19567
LinkDB
Position
5
AA seq 1608 aa
MSGSERAAPALRPRGRLWPVLAVLAAAAAGCARAAMDECTDEGGRSQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLSGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRST
GHGGHCTNCQDNTDGANCERCRENFFRRGNSEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCNPSGSVDECNFETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFQIDEDGWHAEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGTQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTVGGTSDCQPCPCPGGSSC
AVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACDCNPYGTVRQQSGCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGIT
GQHCELCEVNHFGFGHEGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELENLIANLGTGDEMVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARARVEST
EQLIEIASRELEKAKIAVANVSITQPDSTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANETSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISEDLEKQASRVHEEAKRAG
DKAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMRGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNK
TAAEEALRRIPAINQTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSATSLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 4827 nt   +upstreamnt  +downstreamnt
atgagcggcagcgagcgggccgcgccggcgctgcggccccgcgggcggctctggccggtg
ttggcggtgctggcggccgccgcggccggctgcgcccgggcagccatggacgagtgcacg
gacgagggcgggcggtcgcagcgctgcatgcctgagttcgtcaacgctgccttcaacgtg
accgtggtggccaccaacacgtgcgggactccgcccgaggagtactgtgtgcagaccggg
gtgaccggggtgaccaagtcctgtcacctgtgcgacgccgggcagcctcacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcagagccag
accatgctgtctggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaa
gcctttgatatcacatatgtgcgcctcaagttccacaccagccgcccggagagctttgcc
atttacaagcgcacgcgggaagatgggccctggattccttaccagtactacagcggctcc
tgcgagaacacctactcgaaggcaaaccgtggcttcatcaggacaggaggggacgagcag
caggccttgtgcacggatgaattcagtgacatttcccctctcaccgggggcaacgtggcc
ttttcaacccttgaaggaaggcccagtgcctacaactttgacaacagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaactctcaatcgcctgaacactttcggagat
gaagtgtttaatgaccccaaagtcctcaagtcctattattatgcaatctctgattttgct
gtaggtggtagatgtaaatgtaacggacatgcaagcgagtgtgtgaagaatgaattcgac
aagctggtgtgtaattgcaagcataatacttacggagtagactgtgagaagtgtcttcct
ttcttcaatgaccggccatggaggagggcaactgcagagagtgccagcgaatgcctgccc
tgtgactgcaatggccgatcgcaggaatgctactttgaccctgagctataccggtccact
ggccatggtggccactgtaccaactgccaggataacacagatggcgccaactgtgagagg
tgccgggagaatttcttccgccgtgggaacagtgaagcctgctctccatgccactgtagt
cctgttggttctctcagcacacagtgtgatagctatggcaggtgtagctgtaagccagga
gtgatgggtgacaaatgtgaccgttgccagcctggattccattctctcactgaagcagga
tgcaggccatgctcttgtaatccttctggcagcgtagatgaatgtaattttgaaacagga
agatgtgtttgcaaagacaatgttgaaggcttcaattgtgagagatgcaaacctggattt
tttaatctggaatcatctaatcccaggggttgcacaccctgcttctgctttgggcattct
tctgtctgtacaaatgccgtcggctacagtgtttattctataacctctacctttcagatt
gatgaggatgggtggcatgcggaacaaagggacggctccgaagcatcactggagtggtcc
tctgagaggcaagacatcgccgtcatctcagacagctactttcctaggtacttcattgct
cctgcaaagttcttgggcacgcaggtgttgagttatggtcagaacctctccttttccttt
cgagtggacaggcgagacactcgcctctctgcagaagacctggtgcttgagggagctggc
ctcagagtgtctgtgcccttgatcgctcagggcaattcctatccgagtgagaccactgtg
aaatacgtcttcaggctccatgaagcaacggattacccttggaggcctactcttacccct
ttcgaatttcaaaagctcttaaacaatttgacctctatcaagatccgtgggacatatagt
gagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcctggg
gtccctgccacttgggtggagtcttgcacctgtcctgtgggatacggaggacagttctgt
gagatgtgtctctcaggttacagaagagaaactccaagtcttggaccatacagtccatgt
gtgctctgtacctgcaatggacacagcgagacctgtgaccctgagacaggtgtttgtaac
tgcagagacaatacagctggcccccactgtgagaagtgtagtgacgggtactatggagat
tccacagtgggcggcacctctgattgccagccgtgtccatgtcccggaggctcaagctgt
gcagttgtccctaagacacaggaggtggtgtgcaccaactgtcctactggcaccaccggt
aaaagatgtgagctctgtgatgatggctactttggagaccctctgggtagaaatggccct
gtgaggctttgccgcctgtgccagtgcaatgacaacatcgatcctaacgcagttggaaat
tgcaatcgcttgacgggagaatgcctaaaatgcatctataacactgccggcttctattgt
gaccggtgcaaagaaggattttttggaaatcccctggctcctaatccagcagacaaatgc
aaagcctgtgattgcaacccctatgggaccgtgaggcagcagagtggctgtaaccctgtg
accgggcagtgtgaatgtctgcctcacgtgaccggccgggactgtggagcttgtgaccct
ggattctacaacctgcagagcgggcaaggctgtgagaggtgtgactgccatgctttgggt
tccaccaacgggcagtgtgacatccgcactggccagtgtgagtgccagcctggcatcacc
ggtcagcactgtgagctctgtgaggtcaaccactttggctttggacacgaaggctgcaaa
ccctgtgactgtcatcctgagggatctctttcactccagtgcaaagatgatggtcgctgt
gaatgcaaagaaggttttgtgggaaatcgctgtgaccaatgtgaagagaactatttctac
aatcggtcttggcctggctgccaggaatgtccagcatgttaccggctggtgaaggataag
gttgctgatcatcgagtgaaactccaggaattagagaatctgatagcaaatcttggaact
ggggatgagatggtgacggatcaagcctttgaggacagactaaaggaagcagagagagaa
gttatggacctccttcgtgaggcccaggacgtcaaagatgtagaccaaaatctgatggat
cgcctccagagagtgaataacaccttatctagccaaattagccgtttacagaatatccgg
aataccattgaagagactggaaacttggctgaacaagcacgtgcccgggtagaaagcaca
gagcagttaattgaaatcgcatccagagaactggagaaagcaaagattgctgttgccaat
gtgtcgatcactcagccagactctacgggggacccaaacaacatgactcttttggcagaa
gaggcgcgaaagcttgctgaacgccataaacaagaagccgatgacattgtacgagtggca
aagacagccaatgagacatcaactgaagcgtataatttgcttttgaggacactggcagga
gaaaaccaaacggcatttgagattgaagagcttaatagaaagtatgaacaagcaaagaac
atctcagaggatctagagaagcaagcttcccgagtacacgaggaggccaaaagggctggt
gacaaagctgtggagatctacgccagcgtggcccagctgactcctgtggactcagaagcg
ctggagaatgaggcaaataaaataaaaaaggaagctgaggatctggaccgtctgattgac
cagaagttgaaagattatgaggatctgagagaggacatgagagggaaggaacttgaagta
aagaaccttctggagaagggaaagactgaacagcagactgctgaccagctcctagcccga
gctgatgctgccaaggctcttgcagaagaagctgctaaaaagggacgaaatacgttacaa
gaagccaatgacattctcaacaacctgaaagattttgataggcgcgtgaacgacaacaag
actgctgccgaggaggcgctccggaggattcctgccatcaaccagaccatagctgaagcc
aacgagaagacaagggaggcacagctggcgctgggcaacgctgctgccgacgccaccgag
gctaagaacaaggcccacgaggcggagaggatcgccagcgctgtccaaaagaatgctacc
agcacgaaggcagaagctgaaaggacttttgcagaggttacagacctggataacgaggtg
aacaatatgttgaaacaactacaggaagcagaaaaggagctgaagaaaaaacaagatgat
gctgaccaggatatgatgatggcagggatggcttcacaggctgctcaagaagccgagatc
aatgccagaaaggccaaaaactccgctaccagcctcctcaaccttattaatgacctcttg
gagcagctggggcagctggacacagtggacctgaataagctaaatgagattgaaggcacc
ctgaacaaagccaaagatgaaatgaaagtcagtgatctagacaggaaggtgtcggacctg
gagaatgaagccaagaagcaggaggctgccatcatggactataacagagatattgaggag
atcatgaaggacattcgcaacctggaagacatcaagaagaccttaccgtctggctgcttc
aacacgccgtccattgaaaagccctag

KEGG   Equus caballus (horse): 100056564
Entry
100056564         CDS       T01058                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100056564 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100056564 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100056564 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056564 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100056564 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100056564 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100056564 (LAMB3)
   05145 Toxoplasmosis
    100056564 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II ATG16 F5_F8_type_C DUF745 BNR_6
Other DBs
NCBI-GeneID: 100056564
NCBI-ProteinID: XP_023496552
LinkDB
Position
5
AA seq 1172 aa
MRLLLLLCFVLPSLVCAQQACSRGACYPPVGDLLIGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRLPHNYNSHRVENVASSSGPMRWWQSKNDVSPVSLQLDLDKRFQLQDIV
MEFKAPMPAGMLIERSSDFGKTWRVYQYLAADCTSAFPRVRQGQPQSWQDVRCQSLPQRP
NGHLEGGKVQLHLMDLASGIPATQSQKIQELGEITNLRVNFTRLAPLPQRGYHPPSAYYA
VSQLRLQGSCLCHGHADRCAPRPGAPAGPSTTVQVHEVCVCQHNTAGPNCERCAPFYNNR
PWRPADDQDPHECQRCDCNGHSETCHFDPAVFAASQGAHGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGAPIQETCIPCECDPDGAVPGAPCDPLTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCSVLGSRRDMPCDEESGRCLCLPHVVGPKCDQCAPHHWKLASGRGCEP
CACDPRNSLSPQCNQLTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAAAGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCDRYPVCVACHPCFQSYDADLREQARRLS
GLRNTTASLWAGPGLEDRGLASRIQDAKSKIEQIQAILGSTVFPEQEVAWVANAILSLRR
TLQGLQLDLPREEGTLSLSGDLEGLDKSFNRLLIMYQHKREQFEGLHGADPSGAFRMLTA
AYQRSSQAAQQVSESSRLLQQLRDSWREAEGLEQQIGAGGGASGPQLAALRLEMASLPDL
TPTINKLCGGSRQTACTPGACPGELCPRDNGTTCGSHCRGTLPRAGGAFWTAGQVAKQLQ
GFNAQLQQTRQMIRAAEEAASQVQSDAQRLETQVSTSRSQMEEDVQRTRLLIQQVRDFLS
DPDTDAATIQEVSEAVLALWLPTDSVTVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEQARSRAHAVEGQVEDVVGNLRHGTVALQEAQDTMQGTSRSLRLIQDRVTEVQQ
VVGPAERLVTGMMEQLGDFRARMETLRRLARQQRAQAAQAQQLAEDASERALSAQEGFDR
IKQKYAELKDRLGRSPMLGEQGSRILSVKTEAEELFGETMEMMDRMKDMESELQRGSQAI
MLRSADLTGLEKRVEQIRDYINGRVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaggctactccttctcctgtgttttgtcttgcccagcctcgtgtgtgcccagcaagcc
tgctcccgtggggcctgctatccacctgttggggacctactcattgggaggacccggttt
ctccgagcttcatccacctgtggactgaccaagcctgagacctactgcacccagtatggc
gagtggcagatgaaatgctgcaagtgtgactccaggttgcctcacaattacaacagtcac
cgtgtggagaatgtggcttcgtcctcaggccccatgcgctggtggcagtcaaagaatgat
gtgagccctgtttctctgcagctggacctggacaagagattccagcttcaagacatcgtg
atggagtttaaggcgcccatgcccgctgggatgctgatcgagcgctcctcggacttcggc
aagacctggcgggtgtaccagtacctggctgccgactgcacctctgccttcccccgagtc
cgccagggccagcctcagagctggcaggatgttcggtgccagtccctgccccagaggcct
aacgggcacctagaaggggggaaggtccagcttcacctcatggatttagcctctgggatt
ccagccactcaaagtcaaaaaattcaagagctgggggagatcacaaacttgagagtcaac
ttcaccaggctggcccctttgccccagaggggctaccatccccccagtgcctactatgca
gtgtcccagctgcgtctgcaggggagctgcctctgtcacggccacgctgaccgctgcgcc
cccaggcccggagcgcctgccggcccctccaccactgtgcaggtccatgaggtctgcgtc
tgccagcacaacaccgccggccccaattgtgaacgctgtgcgcccttctacaacaatcgg
ccctggagacctgcggatgaccaggacccccatgaatgccaaaggtgtgactgcaatggg
cactcggagacgtgtcacttcgacccagctgtgtttgccgccagccagggggcacacgga
ggggtatgtgacaactgccgcgaccacactgagggcaagaactgtgagcgatgtcagctt
cactatttccgaaaccggcgtcctggtgctcccattcaggagacctgcatcccctgcgag
tgtgatcctgatggggcagtgccgggggctccctgtgacccactgaccgggcagtgcgtg
tgcaaggagcatgtgcagggggagcgctgtgacctgtgcaagccaggatttacaggactc
acctacgccaacccacagggctgccaccgctgtgactgcagtgtcctggggtcccggcga
gacatgccatgtgacgaggagagtgggcgctgcctgtgtctgccccacgtggtgggcccc
aaatgtgaccagtgtgctccccaccactggaagctggccagtggtcggggctgtgaaccg
tgtgcctgcgacccccgcaactccctcagcccccagtgcaaccagttaacagggcagtgc
ccctgtcgggaagggtttggtggcctgacctgcagtgctgcagccatccgccagtgtcct
gacaggacctatggagatgcagccgcgggatgccgagcctgtgactgtgacttccgggga
actgaaggcccaggctgtgacaaggcctcaggccgctgcctctgccgccccggcttgact
gggccccgctgcgaccagtgccagcgaggctactgtgaccgctacccagtgtgcgtggcc
tgccacccttgcttccagagctatgacgcggacctccgggaacaggcccggcgcctcagt
ggcctccgaaacaccaccgccagcctgtgggctgggcccggcttggaggaccgcggtctg
gcctctcggatccaggacgcgaagagcaagattgagcagatccaagcaattcttggcagc
actgtgttcccagagcaggaggtggcctgggtggccaatgccatcctctccctcaggcgg
actctccagggcctgcagctggatctgccccgagaggaggggaccttgtccctttcggga
gacctggagggtctggacaaaagcttcaatcgcctcctcattatgtatcagcacaagagg
gagcagtttgaaggactacatggtgccgatccttcaggagccttccggatgctgactgca
gcctaccagcggtcatcccaggccgctcagcaggtctccgaaagctcccgcctgctgcaa
cagctcagggacagctggagagaggcagaggggctggagcagcagatcggagcaggagga
ggggccagtggcccccagcttgctgccctgaggctggagatggcttccttgcctgatctg
acacccactatcaacaagctctgtgggggctccaggcagacggcctgcactccaggagca
tgccctggagaactgtgtccccgagataatggcacaacctgtggctcccactgcagaggc
accctccccagggcgggtggggccttctggacggcggggcaggtggccaagcagctgcag
ggcttcaatgcccagctccagcagaccaggcagatgatcagggcagccgaggaagctgcg
tcgcaggtgcaatcagatgctcagcgcctggagacccaggtgagcaccagccgctcccag
atggaggaagacgtccaacgcacgcggctcctcatccagcaagtccgggacttcctctca
gaccctgacactgacgcagccaccatccaggaggtcagcgaggccgtgctggccctgtgg
ctgcccacagactctgtcacagtcctgcagaagatgaatgagatccaggccattgcagcc
aggctccccaacgtggacctggtgctgtcccagaccaagcaggacattgctcgggcgcgc
aggctccaggctgaggccgagcaggccaggagccgcgcccatgcagtggagggccaggtg
gaggacgtggtagggaacctgcggcatggcacggtggctctgcaggaagctcaggacacc
atgcaaggcaccagccgctccctccggcttatccaggacagggttacggaggttcagcag
gtagtgggaccagcggaaagactggtgactggcatgatggagcagctgggtgacttccga
gcacgaatggagacgctccgccgcctggccaggcagcagcgggcgcaggcagcccaggcc
cagcagctcgcggaggatgccagtgagcgggcactgagtgcccaggagggatttgacaga
ataaagcaaaagtatgctgagctgaaggaccggttgggtcggagccccatgctgggagag
cagggcagccggatcctgagcgtcaagacggaggcagaggaactgttcggggagaccatg
gagatgatggacaggatgaaagacatggagtcagagctgcagcgggggagccaggccatc
atgcttcgctcggcggacctgacagggctggagaagcgcgtggagcagatccgtgactac
attaacgggcgtgtgctctactatgccacttgcaagtga

KEGG   Equus caballus (horse): 100058057
Entry
100058057         CDS       T01058                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100058057 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100058057 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100058057 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058057 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100058057 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100058057 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100058057 (LAMA5)
   05145 Toxoplasmosis
    100058057 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 DUF948
Other DBs
NCBI-GeneID: 100058057
NCBI-ProteinID: XP_023482638
Ensembl: ENSECAG00000023274
VGNC: 19564
LinkDB
Position
22
AA seq 3696 aa
MAKPGARHFAGSARCAGGPRGPARLLLAGLALLGAARAQETAGDGFSLHPPYFNLAEGAR
IAASATCGEEAPARGVPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNRAHPV
SNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTD
FGHTYQPWQFFASSKRDCLERFGPRTLERVTRDDDVICTTEYSRIVPLENGEIVVSLVNG
RPGATNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIG
GRCVCHGHADVCDAKDPTDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDNANECQ
SCNCHSHAHDCYYDPEVDRRNASQNQDNVYQGGGVCIDCQHHTTGINCERCLPGFYRAPD
QPLDSPYACRRCNCESDFTDGTCEDLTGRCYCRPNFTGERCDACAEGFTGFPLCHPVASF
PNDTGEQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCVCKPNFQGTHCELCAPGFYGPG
CQPCRCSSPGVADGDCDRDSGQCQCRTGFEGAACDRCAPGYFHFPLCRLCGCSPSGTLPE
GCDEAGRCLCRPEFDGPHCDRCRPGHHGYPDCRACACDPRGALDQLCGVGGVCHCRPGYM
GTTCQECSPGFHGFPDCAPCHCNADGSLHASCDPRSGQCSCRPRVTGLRCDTCVPGAYNF
PYCEAGSCHPAGLAPAVPEAQAPCMCRAHVEGPSCDRCKPGFWGLSPSTPEGCTRCSCDP
RGTLGGVAECQLGSGQCFCKPHVCGQTCAACKDGFFGLDRADYFGCRSCRCDVGGALGQG
CEPRTGACRCRPNTQGLTCSEPARDHYLPDLHHLRLELEEAATPEGHAIRFGFNPLEFEN
FSWRGYAQMTPIQPRIVARLNVSSPDLFRLVFRYVNRGPTSVSGRVSVQEEGKFATCTNC
TEQSQPVAFPPSTEPAFVTVPRRGFGEPFVLNPGTWALLVEATGVLLDYVVLLPSAYYEA
ALLQLRVTEACTFRPTDQRSAENCLLYTHLPLDGFPSAAGPEALCRHDNSLPRPCPTEQL
SPSHPLLAACLGSDVDVQLQVVVPQPGDYALVVDYANEDTRQEVGVAVHTPQRAPQQGAL
TLHPCPYSTLCRGAVLDAQHHLVFFHLDTEASIRLTAEQARFFLHSVTLVPVQAFTLEFL
EPRVHCVSSHGTFGPSSVACLPSRFPKPPQPIVLRDCQVLPLPPGLPLTRSQELTPGAPP
SGPQPRPPTAVDPDVEPTLLRHPQGTVVFTTQVPALGRYAFLLHGYQPAHPTFAVEVLIN
GGRVWQGHANASFCPHGYGCRTLVVCEDQAVLDVTDSELTVTVRVPEGRWLWLEYVLVVP
EDAYSPSYLREEPLDKSYDFISHCAIHGYHISPTSSSPFCRNAATSLSLFYNNGARPCGC
HEVGATSPTCEPFGGQCPCRAYVIGRDCSRCATGYWGFPNCRPCDCSGRLCDELTGQCTC
PPRTVPPDCIICQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDTDSGQCKCRPNVAGRR
CDTCAPGFHGYPACHPCDCHTAGSAPGVCDPLTGQCYCKENVQGPRCDQCRLGTFSLDAA
NPKGCTRCFCFGATERCRSSAHGRWEYVDMEGWALLSTDRQVVPHELRAEAELLHADLRH
VPEAFPELYWQAPPSYLGDRVSSYGGILRYEVHSETQRGDVFIPTESRPDVLLQGNQMSI
TFLEPVYPAPGHVHRGQLQLVEGNFRHAETHSAVSREELMMVLAGLEQLQIRALFSQISS
AVSLRRVALEVASELGGGPPASNVELCMCPASYRGDSCQECAPGYYRDVKGLFLGRCVPC
QCHGHSDRCLPGSGVCVGCQHNTEGDHCEQCQAGFVRSGSEDPAAPCVSCPCPLSVPSNN
FAVGCILRGGRTQCLCKPGYAGASCERCAPGYFGNPLVLGSSCQPCDCSGNGDPNMLFSD
CDPLTGTCRGCLRHTTGPRCESCAPGFYGNALLPGNCSRCDCSPCGTEACDPQSGQCLCK
AGVTGPSCDRCQEGHFGFAGCRGCRPCACGPAAEGSECHPQSGQCHCRPGTGGLQCRECA
PGHWGLPEQGCRRCQCRGGHCDLHTGRCTCPPGLSGERCDTCSHQHQVPVPGRPGGHGVH
CEVCDHCVVLLLDDLERAGALLPAIREQLHGVNASSAAWARLHRLNASIADLQSQLQSPL
GPRHETTQRLEALERQSSSLGQDTQRLDGQATGAQARASQLLDSTEASLGRVQTLLAAIR
AVDSALRELESQTARLSPANDSAPSGEQLRRTVAEVERLLREMRARDLGAPRAAAEAELG
EAQRLLARVQEQLTSLWEGNQALAARTQDQLAQHEAGLMDLREALNRAVGTTREAEELNS
RNQERLEEALQRKQELSQDSATLRATLQAARDTLARLSELLHGIDQAKEECEHLAAGLDG
AWTPLLEKMQAFSPASSKVALVEAAEAHAWQLDQLALNLSSIIRGVNQDGFIQRAIEAAN
AYSSILQAVQAAEGAAGQALQQSSHTWAMVVQQGLAPRAQQLRANSSALEEAVLREQWRL
GRAQATLHGTGTQLRDAQAKKEQLVAQIQEVQAMLAMDTDETSKKIANAKAVAFEAQDTA
ARVQSRLRDMQQTLEQWQGQFGGLQSQDLGQAVLDAGRSVTTLEKTLPQLLAKLSLLENR
GTHNASLALSASIGRVRELIAQARGAASKVKVSMKFNGRSGVQLRTPRDLSDLAAYTSLK
FYLQSPEPARGQAAGDHFVLYMGSRQAAGDYMGVALRDQKVHWVYRLGGAGPAALSIDED
IGEQFAAVSIDRTLQFGHMSVTVENQMVHETKGDTVAPGAEGLLSLQPDDFVFYVGGYPS
NFTPPGPLRLPGYRGCIEMDTLNEEVVSLYNFEKTFRLDTAVDKPCARSKSTGDPWLTDG
SYLDGSGFARISVESQISHTKRFDQELRLVSSSGIIFFLQHQDQFLCLAVREGSLLLLYD
FGTGLKEAVPLQPPPPLTTASKAIQVFLLGGSRKRVLVRVERATVFSVEQENVLELADAY
YLGGVPPDQLPPSLQLLFPSGGSIRGCVKGIKALGKYVDLKRLNTTGVSSGCTTDLLVER
AVTLHGHGFLPLALPDVSPLTGDVYSGFGFRSTRDSGLLYHRASPDGPCEVSLQQGHVTL
RLMRTEVKTRGRFADGAPHYVAFYSNTTGVWLYVDDQLQQMKPHRGPLPRPHPQPEGPPR
LLLGGLPESDTIQNFSGCISNVFVQRLLGPQRVFDLQENMGGVNVSSGCAPAPHTQTWRQ
APRGLRAAAARKASRRSRQPTQDLACMPPGPFRTIRDAYQFGGPLLSYLEFAHVPAPPGD
WSHLRMLVRPHTPQGLLLFAAPLTASSPSLALFLSHGHFVAQTEGPGPRLRVQSRQRSRA
GRWHKVSVRWEKTRIQLVTDRVRAQGQEGPSQQHQGVEGPRPHTLFVGGLPDGGRSRKLP
VAIISSRFSGCVKGLKLDGQPLGAPTQMVGVTPCFSGPLEKGLFFAGSGGVVTLDTLGAT
LPNVGLELEVRPQAASGLVFHLGQVQAPPYLQLQVLEKQVLLRADDGAGEFSTVVTHPAV
VCDGQWHRLAVTKDGNMLRLEVDRQSNHTLGPMLATSADALAPLHLGGLPEPMDAHAGLP
AYRGCMRNLVVNRAPVTLPHSAGVQGVVGASGCPAT
NT seq 11091 nt   +upstreamnt  +downstreamnt
atggcgaagccgggcgcgcggcacttcgcggggagcgcacggtgcgcgggcggcccccgg
ggccccgcgcggctgctgctggccgggctggcgctgctgggcgcggcgcgggcgcaggag
acggcgggcgacggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgc
atcgccgcctcggccacctgcggcgaggaggccccggcgcgcggggtcccgcgccccacc
gaggacctctactgcaagctggtggggggccccgtggccggcggggatcccaaccagacc
atccagggccagtactgcgacatctgcacagctgcaaacagcaacagggcacaccccgtg
agcaacgccatcgacggcacggagcgctggtggcagagcccgccactgtcccgcggcctg
gagtacaatgaggtcaacgtcaccttggacctgggccaggttttccatgtggcgtatgtg
ctcatcaagtttgccaactcccctcggccagacctctgggtgctggagcggtccacggac
ttcggccacacctaccagccgtggcagttctttgcctcctccaagagggactgcctggag
cgattcgggccgcggacgctggagcgtgtcacgcgggacgacgatgtcatctgcaccacg
gagtactcccggatagtgccactggagaacggcgagatcgtagtgtccctagtgaacggg
cggccgggagccaccaacttctcctactcacccctgctgcgcgacttcaccaaagccacc
aacatccgcctgcgcttcctgcgcaccaacacgctgctgggccacctcatgggcaaggcg
ctgcgcgaccccaccgtgacccgccggtactattacagcatcaaggacatcagcatcggc
ggccgctgtgtctgccatggtcacgcagatgtctgtgatgccaaagaccccacagacccc
ttcaggctgcagtgcgcctgccagcacaacacatgtgggggctcctgtgaccgctgctgc
cctggcttcaaccagcagccatggaagcctgccaccactgacaatgccaacgagtgccag
tcctgcaactgccacagccatgcccacgactgctactacgaccccgaggtggaccggcgc
aatgccagccagaaccaggacaacgtctaccagggtgggggcgtgtgcatcgactgccag
catcacaccaccggcatcaactgtgaacgctgcctgcccggcttctaccgcgccccagac
cagccccttgactcaccatacgcctgccgccgctgcaactgcgagtcggacttcaccgat
gggacgtgtgaggacctgacgggccgctgctactgccggccgaacttcacgggggagcgg
tgcgacgcgtgtgccgagggcttcaccggcttcccgctctgccacccggtggcctccttc
cccaacgacaccggggaacaggtgctgccggccggacagatcgtgaactgtgactgcagt
gccgccgggacccagggcaatgcctgccggaaggacccaagggtgggacgctgtgtatgc
aaacccaacttccagggcacccactgcgagctctgtgccccagggttctacggcccgggc
tgccagccatgccggtgttccagccccggtgtggcagatggtgactgtgaccgcgactcg
ggccagtgccagtgccggactggcttcgaaggggctgcctgtgaccgctgtgcccccggc
tacttccacttccctctctgccggttgtgcggctgcagcccttcagggaccctgcccgag
ggctgtgacgaggctggccgctgcctatgccgacctgagtttgatggccctcactgtgac
cgctgccggcctggccaccatggctaccccgactgccgtgcctgtgcctgtgacccccgg
ggtgccctggaccagctctgtggagtgggtggcgtatgccactgccgccctggctatatg
gggaccacctgccaggagtgcagccccggcttccacggcttccccgactgtgccccctgc
cactgcaatgccgacggctccctacatgcatcctgcgaccctcgcagcgggcagtgcagc
tgccggccccgtgtgacggggctgcggtgtgacacatgtgtgcccggtgcttacaacttc
ccctactgtgaagctggctcctgccaccctgctggcctggccccagccgttcctgaggca
caggccccctgtatgtgccgggctcatgtggagggaccaagctgcgatcgctgtaaaccc
gggttctgggggctgagtccaagcacccctgaaggctgtacccgctgcagctgtgacccc
aggggcacactgggtggagttgccgagtgccagctgggcagcggccagtgcttctgcaag
ccccacgtgtgtggccagacctgcgcggcgtgcaaggatggcttcttcgggctggaccgg
gctgactacttcggctgccgcagctgccgctgtgatgttggtggtgcgctgggccagggc
tgtgaaccgaggacaggcgcctgccggtgtcgccccaacacccagggcctcacctgcagc
gagccagcgcgggaccactacctccccgacctgcaccacctgcgcctggagctggaggag
gcagccacgcctgagggccacgccatacgcttcggcttcaaccccctggagttcgagaac
ttcagctggaggggctatgcgcagatgacgcccatccagcccaggatcgtggcgaggctg
aacgtgagctcccctgacctcttccggctggtcttccgatacgtcaaccgtgggcccaca
agtgtgagtgggcgggtgtctgtgcaagaggagggcaagtttgccacctgcaccaactgc
acagagcagagccagccggtggccttcccgcccagcacggagcctgccttcgtcaccgtg
ccccggagaggctttggggagccctttgtgctgaaccctggcacctgggccctgctcgtg
gaggccacaggggtgctcctggactatgtggtcctgctgcctagcgcgtactacgaggcg
gccctcctgcagctgcgggtgaccgaggcctgcacgttccggcccactgaccagcgctct
gcagagaactgcctcctgtacacccacctgcccctggacggcttcccctcggccgctggg
cccgaagccctctgtcgtcatgacaacagccttcctcggccctgccccacggagcagctc
agcccctcccacccgctgctggccgcctgcctaggcagtgacgtggatgtccagctgcag
gtggtggtgccgcagccaggcgactatgccctggtggtggactacgccaatgaagacacc
cgccaggaggtgggcgtggcggtgcacactccccagcgggcccctcagcagggggcactc
accctccacccctgtccatacagcaccctgtgccgaggtgctgtcctggacgcccagcac
cacctggtgttcttccatctggacacagaggccagcatccggctcacagctgagcaggcg
cgcttcttcctgcacagcgtcaccctggtgcctgtgcaggcgttcaccttggagttcctg
gagccccgggtccactgcgtcagcagccacggcaccttcggccccagcagtgttgcctgc
ctgccctcccgcttcccgaagccgccccagcccatcgtcctcagggactgccaggtgctg
ccactgcctcccggcctcccgctgacccgctcgcaggagctcacaccaggtgcacccccg
tctgggccccagcctcgaccccccaccgccgtggaccccgatgtggagcccaccctgctg
cgccaccctcagggcacggtggtcttcaccacccaggtgcccgccctgggccgctatgcc
ttcctgttgcacggctaccagccggcccatcccaccttcgccgtggaggtcctcatcaac
gggggccgtgtctggcagggccatgccaacgccagcttctgcccgcatggctacggctgc
cgcaccctggtggtgtgtgaggaccaggctgtcctggatgtgaccgacagtgagctcact
gtgactgtgcgtgtgcccgagggccggtggctctggctggagtacgtgttagtggtccct
gaggacgcctacagccccagctacctccgggaggagcccctggacaaatcctacgacttc
atcagccactgtgccatccacggttaccacatcagccccaccagctcgtccccgttctgc
cgcaacgccgccacctcgctctctctcttctacaacaacggggctcggccctgtggctgc
cacgaagtgggtgccacgagccccacgtgtgagcccttcgggggccagtgtccttgccgc
gcctacgtcatcggccgcgactgctcccgctgcgccactggctactggggcttccccaac
tgcaggccctgcgactgcagcggccgcctctgtgacgagctcacaggccagtgcacctgc
cctccccgcaccgtcccacccgactgcatcatctgccagccccagaccttcggctgccac
cccctggtcggctgtgaggagtgtaactgctcggggcctggcgtccaggagctcacggac
cccacctgtgacacggacagcggccagtgcaagtgcagacccaacgtggccgggcgccgc
tgtgacacttgtgcccccggcttccacggctaccccgcctgccacccttgtgactgccac
acagcaggctctgcccctggcgtgtgcgaccccctcacaggccagtgctactgcaaggag
aacgtgcagggcccgaggtgtgaccagtgccgccttgggaccttctccctcgatgccgcc
aaccccaaaggttgcacccgctgcttctgctttggggccacggagcgctgcaggagctcg
gcccacggccgctgggagtacgtggacatggagggctgggcgctgctgagcactgaccgg
caggtagtgccccacgagctgcgggcagaggcggaactgctccacgctgacctgcggcac
gtgcctgaggccttccccgagctgtactggcaggccccaccctcctacctcggggaccgg
gtgtcatcctacggcgggatcctccgctatgaagtgcactcggagacccagcggggggac
gtgttcatccccacggagagcaggccggatgtgctgctgcagggcaaccagatgagcatc
acattcctggagccggtgtacccggcgcccggccacgttcaccgtgggcagctgcagctg
gtggaggggaacttccggcatgcggagacccacagcgccgtgtcgcgcgaggagctcatg
atggtgctggccggcctggagcagctgcagatccgtgccctcttctcacagatctcctcg
gccgtctccctgcgcagggtggcgctcgaggtggccagcgagctgggcggggggcctcca
gccagcaacgtggagctgtgcatgtgccctgccagctaccgtggggactcctgccaggaa
tgtgcccccggctattatcgggacgtcaaaggtctcttcttgggtcgctgtgtcccttgt
caatgccatggccactcagaccgttgccttcctggctcgggcgtctgcgtgggctgccag
cacaacactgaaggtgaccactgtgagcagtgccaggctggctttgtgcgcagtgggtca
gaggaccctgcagccccctgtgtcagctgcccctgccccctgtcagtgccttccaacaat
tttgccgtgggctgcatcctgcgaggcggccgcacccagtgtctctgcaaacccggctat
gcgggggcttcctgtgagcggtgcgcacccggctactttgggaacccactggtgctgggc
agctcatgccagccctgtgactgcagcggcaacggtgaccccaacatgctcttcagcgac
tgtgaccccttgacgggcacctgccgcggctgcctccgccacaccactgggccccgctgc
gagagctgcgcccctggcttctacggcaacgccttgctgcccggcaactgcagccggtgt
gactgttccccatgtgggactgaggcctgcgacccccaaagcgggcagtgcctgtgcaag
gcaggtgtgacagggccaagctgtgaccgctgtcaggaaggacacttcggcttcgcgggc
tgcaggggctgccgcccgtgcgcctgtggaccagccgccgagggctccgagtgccacccc
cagagtggacagtgtcactgccgaccagggactgggggtctccagtgccgcgagtgtgcc
cctggccactgggggctccccgagcaaggctgcaggcgctgccagtgccgagggggccac
tgtgacctgcacactggtcgctgcacgtgccccccagggctcagtggcgagcgctgtgac
acttgtagccaccagcaccaggtgcctgtgccaggcaggcctgggggccatggtgtccac
tgtgaagtgtgtgaccactgtgtggtcctgctcctggacgacctggagcgggccggtgcc
ctcctccctgccatccgggagcagctgcacggggtcaatgccagctctgcggcctgggcc
cggctgcacaggctgaacgcctccatcgctgacctgcagagccagctgcagagccccctg
ggcccccgccatgagacaacgcagaggctggaggcgctggagcgacagagctcaagcctt
gggcaggacacacagaggctggacggccaggccacaggggcccaggctcgggccagccaa
ctgctggacagcactgaggcctcgctgggccgggtgcagaccctgctggcggccatccgg
gctgtggacagcgccctgagagagctcgagtcccagacggctcgactgtcaccagccaac
gactcggccccgtcgggtgagcagctgcgccggacagtggccgaggtggagcggctgctc
cgggagatgcgggcccgagacctgggggcccctcgggcagcagctgaggccgagctgggc
gaggcccagagattgctggcccgcgtgcaggagcagctgaccagcctctgggaggggaac
caggcgctggctgcacgcacccaagaccagctggcccagcatgaggccggcctcatggac
ctgcgagaggccctgaaccgggccgtgggcaccacacgggaggctgaggagctcaacagc
cgcaaccaggaacgcctggaggaggccctgcaacggaaacaggagctgtcccaggacagt
gccaccctgagggccactctgcaggctgcccgtgacaccctggcccggctctctgagctt
ctgcatggcatagaccaggccaaggaggagtgcgagcacctcgctgccggactggacggg
gcctggaccccgctgcttgagaagatgcaggccttctctccggcgagcagcaaggtggct
ctggtggaagccgccgaggcccacgcgtggcagctggaccaactggcgctcaacctgtcc
agcatcatccgcggagtcaaccaggacggcttcatccagcgagccatcgaggccgccaac
gcctacagcagcatcctgcaagccgtgcaggctgccgagggtgccgccggccaggcgctg
cagcaatcgagccacacgtgggcgatggtggtgcagcagggcctggcgccccgtgcccag
cagctgcgggccaatagcagtgccctggaggaggccgtcctcagggagcagtggaggctg
ggccgcgcgcaggccaccctccacggcaccgggacccagctccgcgacgcccaggccaaa
aaggagcagctggtagcccagatccaggaggtgcaggccatgctggccatggacacggat
gagaccagcaagaagattgccaatgccaaggctgtggccttcgaagcccaggacacggcg
gcccgcgtgcagtcccggcttcgggacatgcagcagaccctggagcagtggcagggccag
tttggaggcctgcagagccaggacctgggccaggcggtgcttgacgcaggccgctcagtg
accaccctggagaagacgttgccacagctgctggccaagctgagcctcctggaaaaccgt
gggacgcacaatgccagcttggccctgtctgccagcatcggccgtgtgcgggagctcatt
gctcaggcccgaggagctgccagcaaggtcaaagtgtccatgaagttcaacgggcgctcg
ggggtgcagctgcgtaccccccgggacctctcagacctcgctgcctatacctccctcaag
ttctatctgcagagcccggagccagcgcgtggccaggccgctggggaccactttgtgctg
tacatgggcagccgccaggctgcaggtgactacatgggtgtggctctgcgtgaccagaag
gtgcactgggtgtaccgcctggggggggcaggccctgcagccctcagcatcgacgaggac
attggggagcagtttgcagctgtcagcatcgacaggaccctccagtttggccacatgtct
gtcacagtggagaatcagatggtccatgagaccaagggtgacacagtggcccctggggcc
gaggggctgctcagcctgcagcctgacgactttgtcttctacgtggggggctaccccagc
aacttcacgccccccggacccctgcgcctccctggctaccggggctgcattgagatggac
acactcaacgaggaggtggtcagtctctacaacttcgagaagaccttccggctcgacaca
gctgtggataagccctgtgcccgctccaagtcaactggggacccgtggctcacagacggc
tcctacctggacggctctggctttgcccgcatcagcgtggagagtcagatcagccacacc
aagcgctttgaccaggagctgcggctcgtgtcctccagcggcatcatcttcttcctgcag
caccaggaccagttcctgtgcctggctgtgagggaaggcagcctcctgctcctctatgac
tttggcacaggcctgaaggaggctgtcccgctgcaacccccaccgcccctgaccacagcc
agcaaggcaatccaggtgttcctgctcgggggcagccgcaagcgcgtgctggtgcgcgtg
gagagggctaccgtgttcagcgtggagcaggagaacgtgctggagctggccgacgcctac
tacctggggggtgtgccacccgaccagctacccccaagcctgcagctgctgttcccttcc
ggaggctccatccgtggctgtgtcaagggcatcaaagctctgggcaagtacgtggatctc
aagaggctgaacacgacgggcgtcagctccggctgcacaacagacctgctggtggaacgg
gctgtgactctccatggccacggcttcctgcccctggcgctccccgatgtctcgcccctc
acgggtgatgtctactccggctttggcttccgcagcaccagggacagcggtctgctctac
catcgagcgtccccggatgggccgtgcgaggtgtccctgcagcagggccacgtgacactc
cggcttatgaggaccgaggtgaaaacacgagggcgctttgccgatggtgccccccattac
gtagctttctacagcaacaccacaggggtctggctctatgtggacgatcagcttcagcag
atgaagccccaccgtgggccactgccccggccccatccccagcctgaggggccccctcgg
ctcctcctgggaggcttgccagagtctgacaccatccaaaacttcagcggctgcatcagc
aacgtttttgtgcagcggctcctggggccacagcgtgtgtttgacctgcaggagaacatg
ggtggcgtcaacgtgagctcaggctgcgccccagcccctcacacccagacctggaggcag
gcaccgcgaggactgcgggctgcagcagctcggaaggcctcccgccgcagccggcagccc
acccaggaccttgcctgtatgccacctgggcccttcaggaccatccgagatgcctaccag
tttgggggtcctctgctcagttacctggagtttgcacacgtcccggcacctcccggggac
tggtcccacctcaggatgcttgtccgccctcacactccccaagggctcctgctcttcgct
gcccccctgacggccagtagcccctccctggctctcttcctgagccacggacactttgtt
gctcagacggaaggccctgggccccggctccgtgtccagagccgccagcgttcacgggct
ggccggtggcacaaggtgtccgtgcgatgggagaagactcggattcagctggtgacagac
agggtccgggcccagggccaggaggggcccagccagcagcatcagggtgtagagggcccc
cggccccacactctgttcgtgggcggcctccctgatggcggccgcagccgcaaacttcca
gtggccatcatcagctccaggttcagcggttgtgtgaagggactgaagttggacgggcag
cctctgggggcccccacacagatggtgggagtcacgccctgcttctcgggccccctggag
aagggcctgttcttcgcaggaagtgggggagtcgtcactctagacaccctgggggccaca
ctgcccaatgtgggcctggagctggaggtgcggccgcaggcggctagcggcctcgtcttc
cacctgggccaggtgcaggcgcccccctacctgcagctgcaggtgttggagaagcaggtc
ctgctgcgggcggacgatggtgcaggcgagttctccacagtggtgacacacccagccgtg
gtgtgtgacgggcagtggcaccgactggcagtgaccaaagatgggaacatgctccggctg
gaggtggacaggcagagcaaccacaccctgggccccatgctggcaacctcggctgacgcc
ctggcacctctgcaccttgggggtctgcctgagcctatggacgcacacgctgggctgccc
gcctaccgtggctgcatgaggaatctggtggtgaaccgggcccccgtcactttgcctcac
tctgctggtgtccagggggtagtgggggcgagcggctgcccagccacatag

KEGG   Equus caballus (horse): 100059860
Entry
100059860         CDS       T01058                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1 isoform X1
  KO
K05637  laminin, alpha 1/2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
ecb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100059860 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100059860 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100059860 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059860 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100059860 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100059860 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100059860 (LAMA1)
   05414 Dilated cardiomyopathy
    100059860 (LAMA1)
   05416 Viral myocarditis
    100059860 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100059860 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100059860 (LAMA1)
   05145 Toxoplasmosis
    100059860 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_I Laminin_N Laminin_II Laminin_G_3 Hepar_II_III
Other DBs
NCBI-GeneID: 100059860
NCBI-ProteinID: XP_023503191
LinkDB
Position
8
AA seq 3128 aa
MRGGGAGVALLASLLWVAAQCQQRGLFPAILNLASNAHISTNATCGEQGPEMFCKLVEHV
PGRPVRNPQCRICDGSSGNPKERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQQ
FQLILHETWQTQSRTLGEMSIGSNSVEKYIETRNGNQLLTFQVFQVAYVIIKAANAPRPG
NWILERSVDGTKFSPWQYYAVSDTECLTRYNITPRRGPPTYRADDEVICTSYYSRLVPLE
HGEIHTSLINGRPSADDLSPELLEFTSAQYIRLRLQRIRTLNADLMTLSRRDPKDLDPIV
TRRYYYSIKDISVGGMCICYGHASSCPWDETAKKLQCQCEHNTCGESCSTCCPGYHQQPW
RPGTVSSGNTCEECNCHNKAKDCYYDESVANQKRSLNTAGQFKGGGVCINCLQNTMGINC
ETCIDGYYRPHKVSPYEDDPCHPCDCDPLGSLSSVCIKDDLHSDLHKGKWPGQCPCKEGY
TGEKCDRCQFGYKGYPACVLCDCSPAGSVNEDPCSEPCLCKENVEGKNCDGCKPGFYNLK
KGNPQGCSECFCFGVSDVCDSLSWPISQVKDMSGWLVTDLISPSKIPSQQNALGGRPQLS
INHTSVMQRLTSKYYWSAPEAYLGNKLTAFGGFLKYTVSYDVPVETVDSDLMSHSDVIIK
GNGLTLSTQAEGLSLEPYEEYLNVVRLVPENFREFGNKREIDRDRLMTVLANVTHLLIRA
SYNSAKMALYRLDSVSLDTASPNVIDLALAEDVERCECPPGYMGVSCESCLPGYYRVDGI
LFGGICQPCECHGHAAQCDVHGVCSACKHNTTGDHCEQCMPGFYGRASRGTPGDCQPCAC
PLSTASNNFSPTCHLDDGDKVVCDQCAPGYSGAWCERCADGYYGNPTVPGESCVPCNCSG
NVDPLEVGHCDSVTGECLRCTGNTDGAHCERCAAGYYGDAVTAKNCRACECHGQGSLSGV
CHLETGLCDCKPHVTGQQCDQCLRGYYGLDTGLGCSPCNCSASGSTSDDCTEEGQCRCVP
GVAGERCDRCARGFYAYQDGSCTRCDCAHTQNTCDPASGECVCPPHTRGVTCEECGDGYW
GHDPELGCQPCNCSRVGSASRQCDALTGHCQCKPAFSGPSCGQCSLGYRDFPDCVACDCN
LRGTLADTCDGEQGLCSCAEDTGTCSCKENVVGLHCSECRAGTYALRADDALGCAPCFCF
GLSQLCSEAEGYVRTPVTLRPHQPLLRVVSQSDLRGTTQGVYYQAPDILLDAATVRQHVP
AEPLYWRLPGQFQGDQLVAYGGKLKYSVAFYSSNGVGTFNLEPQVLIKGGRTRKQVIYVD
APAPENGVRQEQEVGMKENFWKYFNSVSEKPVTRSDFMSVLSNIEYILIKASYGQGLQQS
RISNVSMEVGREAEGLRPGWAVAALIEKCLCPPGTAGLSCQDCAPGYHRGKLPEGGGRGP
RPLLAPCVPCTCNNHSDACDPDTGTCLNCSDNTAGDHCDVCAPGYYGKVTGSASDCALCA
CPHSRPASFSPTCVLEGDHDFRCDACLLGYEGQYCERCSSGYHGNPRAPGGTCQSCDCSP
RGSVHSDCDRRSGQCVCRPGATGLQCEECEPRHILVESDCISCDDACVGVLLSDLDNIGD
NILSVNLTSIIPAPYGILSNLENTTKYLQESVLKENTQKRLAKVQLESVAEHTDDLQREL
TRVLTSSQHVARETERTLSKSQELVTFTEQLQIHIQEMIEKATTLNQTLDEDFQLPSSTL
QNMQENITSLLEIIQKRHFMQLHQNATLELKAAEDLLSQIQRNYQKPQEELKVLREAASG
LLSKHDSEVQAAAGLVREAEAKTREGSHLLRIVKANLREVSDKKLLVQEEQNLTKILIAE
GRGSLDAATAGANAAQKAVAQLERHRDELLLWTAKIRRHVDDLVMQMSKRRALDLVYRAE
DHAAELQRLAGALDSGLGNVRRVSLNATSATHVHSSVQSRIEASEKLAQGALRTGTEAGL
LSESLASNGKAALQRSSKFLEEGHSLSRKRQVGITLELSKVKNTANRFQENAAEITGQTE
RSLLILRAIPEGVKDKGAKIKELAASANQRAASTLESVGGWSQKLSNTSTDLSRVNATLQ
ETNRLLRDSSMTTLLAGRKVKDVETQANLLFDRLKPLKTLEENLSRNLSEIKLLISQARK
QAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTSEPDNLLFYLGSSTSSDFLAVEM
RRGKVAFLWDMGSGSARLEFPDFPIDDDKWHSISVTRFGNVGSLSVREMSTTQKLPARTR
KSPGTANVLEINNSTLMFVGGLGGHIKKSPAVKVTHFKGCMGEAFLNGQSVGLWNYIERE
GTCHGCFGSPQSDDSSFHFDGSGYSVVEKTLRATVTQIIMLFSTFSPNGLLLYLASNGTK
DFLSIELVHGRIKVTVDLGSGPLALVTDRRYNNGTWYKIAFQRNRKQGLLAVIDAYNTSS
KETKQGETPGASSDLNRLDKDPVYVGGLPRSRVVRKGVTSKSYVGCIKNLEISRSTFDLL
RNSYGVRKGCVLEPIRSVSFLKGGYVELPPKSLSPESELLATFATKNSSGIILAALGKQG
QKQHPRQAHGPSQPFFSVALIEGHIEVHVNAGDGTSLRRALVRAPTGTYGDGREHSISLI
RSGRILSVQLDETTPVEMKLGPSAESRTINVSKLYVGGTPRGEGPAALRMRGSFHGCIRN
LVFNAELLDFTSAVGYEQVDLDTCLLAERPPPALHGEDKALLPEPRPLPSPERCAPDRAP
EYVPNAHQFGLTQGSHFVLAFNESSVRKRLSVQLSLRTFASSGLIYYMAHQNHVDYATLQ
LLGGRLHFLFDLGKGRTKVSHPALLNDGKWHTVKTEYLKRKGFVTVDGQDSPMVPTVGDG
TALDVEGKLYLGGLPSDYRPRDTGHITHSIPACIGEVTVNSKQLDKDSPVSAFAVTRCYA
VAQEGTFFEGSGYAAFAKEGYRVGSDMNITLEFRTSSENGVLLGISSAKVDAIGLEIVNG
KILFHVNNGAGRVTATYEPKATSAVCDGKWHTLQANKSKHRVVLIVDGNAVRAESPHPQS
TSADTNNPIYVGGYPADVRQNCLSSQTSFRGCLRKLALLQGPQVQSCDFSRAFHLQGVFP
HSCPGAEP
NT seq 9387 nt   +upstreamnt  +downstreamnt
atgcgtggcggcggcgcgggggtcgcgctcctggcctcgctgctctgggtcgccgcgcag
tgccagcagagaggcctgtttcctgccattctcaatcttgccagcaatgctcacatcagc
accaatgcgacctgtggcgagcaggggcctgagatgttctgcaaacttgtggagcacgtg
cccggtcggcctgtgcggaacccacagtgccggatctgtgatggcagcagcgggaacccc
aaagaacgccatccaatatcaaatgctatagatggtaccaataactggtggcaaagtccc
agtattcaaaacgggagagaatatcactgggtcacaatcactctggacttaagacagcag
tttcaactaatcctccacgaaacttggcaaactcagtcaagaacacttggtgaaatgagc
attgggagcaattctgtggagaaatacattgagactagaaatggaaaccaacttctcact
tttcaggtcttccaagtcgcgtatgtcatcatcaaagctgctaatgctcctcgacctgga
aactggattttggagcgttctgtggatggcaccaagtttagcccctggcagtattatgca
gttagtgacacggaatgtttgactcgttacaatataactccaagacgggggccacccact
tacagggctgatgacgaagtgatctgcacctcgtattattctagactggtgccgcttgag
catggagagattcatacatcactaatcaatggccgaccgagtgctgatgatctttcaccc
gagttgttggaatttacttctgcgcaatatatccgccttcgcttacagcgcattcgaacc
ctcaacgccgatctcatgaccctcagccgccgtgaccctaaggacctcgatcctattgtt
accagacgatattattattcaataaaagacatttctgttggagggatgtgcatttgttat
ggccatgctagtagctgcccgtgggatgagactgccaagaaactccagtgtcagtgtgaa
cataacacctgtggagagagctgcagtacgtgttgtcctggataccatcagcagccctgg
aggcctgggaccgtttcttctggtaacacatgtgaagaatgtaattgtcacaataaagcc
aaagactgttactatgatgaaagtgttgcaaatcagaagagaagtttgaatacggctggc
cagttcaaaggaggaggggtttgcataaattgcctgcagaacaccatgggaatcaattgt
gaaacctgtattgatggatattatagaccacacaaagtatctccttatgaggatgaccct
tgccatccctgtgactgtgaccctttggggtccctcagttctgtctgtattaaggatgat
ctccattctgacttacacaaagggaagtggccaggtcagtgtccatgcaaggaaggctac
acaggagaaaaatgtgaccgctgccaatttggctataagggctacccagcctgcgtcctc
tgtgactgcagtccggctggcagtgtgaacgaggacccatgctcagagccttgtctctgt
aaggaaaatgttgaggggaaaaattgtgatggctgcaagccgggattctataacttgaag
aaaggaaacccccagggctgctcagagtgcttctgctttggcgtttctgatgtctgcgac
agcctttcttggcccatcagtcaggtgaaagatatgtccgggtggctggtcactgacttg
atcagtccaagtaagatcccgtctcagcagaacgcactgggcgggcgcccgcagctcagc
atcaaccacacgtcggtcatgcagaggctcacttccaagtactactggtcggcccccgag
gcctacctcggaaataagctgactgcgtttggtgggttcctgaagtacacggtgtcttac
gatgtcccagtggagacagtggacagtgacctcatgtctcattctgacgtcatcattaag
ggaaatggactaactttaagcacgcaggctgagggcctgtcgttggaaccctacgaggag
taccttaatgtggttagacttgtgcccgagaacttccgagagtttggtaacaaaagggag
atagaccgtgaccggctgatgaccgtccttgccaacgtgacacatctcttgatccgagcc
agctacaactctgcaaaaatggctctctacaggttggattctgtctctctggacacagcc
agccccaatgttatagacctggccctggccgaggacgtggagcgctgcgaatgtccccca
ggctacatgggcgtctcctgtgagtcctgcctccccggctattaccgcgtggacggaata
ctcttcggaggaatttgccagccctgcgaatgccacggccacgcggcgcagtgcgacgtc
cacggcgtttgctctgcgtgcaagcacaacaccactggggaccactgtgagcagtgcatg
cccggcttctatgggcgggcgtcccgagggactcctggggactgccagccgtgtgcctgc
cccctctccacagcctccaacaatttcagccccacctgccacctagatgatggagacaaa
gtggtctgcgaccagtgtgccccggggtactcgggggcttggtgtgagagatgcgcagac
ggttactatggaaacccaacagtgcctggggaatcctgtgttccgtgtaactgcagcggc
aatgtcgaccccttagaggttggtcactgtgattctgtcaccggagaatgcctgaggtgc
actggaaacacagatggcgcccactgtgagaggtgtgctgctgggtactacggggacgct
gtgactgctaaaaattgccgagcttgtgaatgccatggacaaggctccctttctggtgtc
tgccatcttgagactggactctgtgactgcaaaccacatgtgaccggacagcagtgcgac
cagtgcttgcgtggctattacggcttggacacagggctcggctgctcgccctgtaactgc
agcgcctcgggctccacgtcggacgactgcacagaggaaggccagtgtcgctgcgtgcca
ggtgtcgccggggaaaggtgtgacaggtgtgcccgtggcttctatgcgtaccaggatggt
agctgcacacgctgtgactgcgctcacactcagaatacttgtgacccagcatcgggggag
tgtgtctgccctccacacactcgaggcgtcacatgtgaagaatgtggggacggatactgg
ggccacgacccagagctcgggtgccagccctgcaactgcagtcgtgtagggtcagccagt
cgccagtgcgatgcgctcactggtcactgccagtgtaagcctgcgttcagtggaccgagc
tgcgggcagtgctccctgggctacagggactttccagactgtgtggcctgtgactgcaac
ctgagagggacgttggcagacacctgtgatggggagcagggtctctgcagctgtgcagag
gacaccggcacctgctcttgcaaggaaaacgtcgttggccttcattgcagcgagtgccga
gcgggcacctacgctctccgcgccgacgacgccctgggctgcgccccatgcttctgcttt
gggctgtcacagctctgctcggaggcggagggttatgtgaggaccccagtaacgctgcgc
ccccatcaaccccttctgcgtgtggtttctcagagtgacctcaggggtacgacgcagggg
gtgtattaccaggcccctgacatcctcctggacgccgccaccgtcaggcagcacgtccct
gcagagccactttactggcggctgcccgggcagttccagggagaccagctcgtggcctat
ggtggcaagctcaagtacagcgtggccttctattcctccaatggcgtcggcaccttcaac
cttgagcctcaagtgctcatcaaaggaggccggacgagaaagcaagtcatttacgtggat
gcgcctgcaccagagaacggagtgagacaagagcaggaagtagggatgaaagagaatttt
tggaaatattttaactctgtttctgaaaaacctgtcacacgttcggattttatgtctgtt
cttagcaacattgagtacattctcatcaaagcgtcgtacggtcaaggattacagcaaagc
aggatctcgaatgtctcgatggaggttggcagagaggcggaagggctgcgcccagggtgg
gcggtggcggccctcatagagaagtgcctctgtccccctggcacggccgggctctcatgt
caggactgtgcacccggataccacagagggaagcttccagaaggtggtggcagaggaccc
cgccctctgctggctccttgtgtgccctgcacttgcaacaaccacagtgacgcttgtgac
ccggacactgggacgtgtctgaactgcagtgacaacaccgctggcgaccactgtgacgtc
tgtgctcccgggtactatgggaaggtgactggttcggccagcgactgcgctctctgcgcc
tgtcctcacagccgccctgccagtttcagtcctacgtgtgtcttggaaggtgatcacgat
ttccgctgcgatgcctgtcttctgggctatgaaggacagtactgtgaaaggtgctcttca
ggctaccacgggaaccctcgagcaccaggtggcacttgccagagctgtgactgcagcccg
cgtggctctgttcacagcgactgtgaccgcaggtccgggcagtgtgtctgcaggccaggg
gccacggggctccaatgtgaggagtgtgaaccgaggcacattctggtggaaagcgattgt
atttcttgtgatgatgcatgtgtaggtgtgctgctgagtgacttggataacatcggtgat
aacattctttctgtgaacctcaccagcattatccctgctccctatggaattttgtcaaac
ctggaaaatacaactaaatatctccaggaatctgtattaaaagaaaatacacaaaagaga
ctggcaaaagttcagcttgaaagtgttgcagaacatacggatgacctgcaaagggagctc
actagagtgttaacaagtagccagcacgtggccagggagactgaaagaaccctcagcaag
agtcaagagctcgtgacatttacagagcagctgcagatacacatccaagaaatgattgaa
aaggcaacaactctaaatcagaccttagatgaagatttccaactacccagttctactctt
cagaatatgcaagagaacattacatctttgctggaaatcatacagaaaaggcattttatg
cagttgcaccaaaatgccacccttgaactcaaggctgctgaagatttattgtcacagatt
cagagaaattatcagaagccacaagaagaactgaaggtattaagagaggcagcaagcggc
ctcctttccaaacacgacagtgaggtgcaggcggccgcaggcctcgtgagggaagcggag
gccaagacgcgggaaggcagccacctgctgcgcattgtcaaggccaacctgcgagaagtc
agtgataagaagctgcttgttcaagaagaacagaacttgaccaaaatactaattgccgaa
ggaagaggatccctagatgctgccactgcaggtgcaaacgctgcacaaaaggctgtagcg
cagttagagcgtcaccgggatgagctacttttgtggactgccaaaatcaggcgccatgta
gatgatctggtcatgcagatgtccaaaagaagagcccttgaccttgtctacagagctgag
gaccatgcagctgagctccagagactagcaggtgctctggacagcggccttggaaatgtt
agacgtgtgtccctgaacgcgaccagtgccacccacgtccattccagtgtgcagagccgg
atcgaagcatcagagaagctggcacaaggtgctctcaggactgggactgaggctggcctg
ctctccgagtcccttgcttctaatgggaaggcggctctccagcgcagttccaaatttcta
gaagaaggccacagcctgagcagaaagcgtcaagtaggtatcacattggaactgagtaaa
gtgaaaaatacagcaaacagatttcaagagaatgctgctgaaattactgggcagacggag
agatcactcttgatccttagagcaattcctgaaggtgtcaaagacaaaggagccaaaatc
aaagagctggccgcctctgcaaaccagagggctgcgagcactctggagagcgttgggggc
tggagccagaagctgtcgaatacatcgactgacctgtccagagtgaacgccacgttacaa
gaaacaaaccgacttctgcgtgactcctcaatgaccactctgttagctggaagaaaagtt
aaagatgtggaaacgcaagccaaccttttatttgaccgtttgaagcctttgaagacatta
gaagagaacctgagcagaaacctatcagaaattaaactgctgatcagccaggcccggaaa
caagcagcttcaattaaagttgctgtgtctgcagacagagactgcatccgggcctaccag
cctcagatttcttccacgaactataacaccttgacactgaacgtgaagacgagcgagcca
gataaccttctcttctacctgggcagcagcaccagctctgatttcctggcagtggagatg
cggcgagggaaagtggccttcctctgggatatgggctccgggtcagcacgcttggaattt
ccagatttcccaattgatgacgacaaatggcatagcatttctgtaaccaggtttggaaac
gttggttcgttgagtgtaagagaaatgagcacaactcaaaagctgccagcaagaacaagg
aaatctcctgggacggctaatgtcctggagataaacaattcaaccctcatgtttgttgga
gggctgggaggacacatcaagaagtctcctgctgtgaaggttactcattttaaaggctgc
atgggagaggccttcttgaatggacagtcagtcggcctgtggaactatattgaaagggaa
gggacgtgccatggctgcttcggaagcccccagagtgacgactcctccttccatttcgac
gggagcgggtactctgtcgtggagaagacgctccgggctaccgtgactcagataatcatg
ctttttagtaccttctcacctaatgggctgcttctctaccttgcttcaaatggcaccaaa
gactttttatccatcgagctggtccacggcagaattaaagtaacagttgacctgggctcc
gggcctcttgcccttgttacggacagacgctacaacaacgggacctggtacaaaattgcc
ttccagcgaaaccgaaagcaaggcctcctagcagtgattgatgcgtataacaccagttct
aaagaaaccaagcaaggtgaaactccaggagcgtcttctgacctcaatcgtcttgataag
gatccagtgtatgtgggtggattacctaggtcaagagttgtaaggaaaggtgtcaccagc
aaaagctatgtgggttgtatcaaaaacctggaaatatccagatcgacctttgatttactc
agaaattcgtatggagtgagaaaaggctgcgtactggagcctatccgaagtgttagcttc
ttgaaaggcggctacgttgaattgccacccaagtctttgtcaccagaatcggaattgttg
gcaacatttgccaccaagaacagcagtggcatcatcctggctgcgctgggcaagcagggg
cagaagcagcatcctcggcaggctcatgggccttcccagcccttcttttccgtcgcgctg
atagaaggccacattgaagtgcacgttaatgctggggatggaacaagcctgaggagagct
ctcgtgcgtgctcccacgggcacatatggcgacggacgggaacattccatctccttgatc
aggagtgggagaattctctctgtccagttggatgagacaactcctgtagaaatgaagttg
ggcccgtcagcagaaagcaggacaataaacgtgtccaagctgtacgtagggggcactccc
cggggagaggggccagcggcgctcaggatgagaggctcgttccacggctgcatccggaac
ctggtctttaatgcagaacttttggatttcacgagtgcagttggctatgaacaagtggac
ttggacacctgccttcttgcagaaaggcctccgccggctcttcatggagaggacaaggca
ctcctgcccgagccccggccgttaccgagcccagaacggtgtgccccggaccgagcccca
gagtatgtccccaatgctcaccagtttggcctcacacaaggcagccatttcgtgttggct
ttcaacgagtcatctgtcagaaagaggctctcggttcagctcagtctccgaacgtttgcc
tccagcggtctgatctactacatggcccatcagaaccacgttgattacgccaccctccag
ctgctggggggccgcctccacttcctgtttgaccttgggaaaggcagaacaaaggtctcc
caccccgcactgctcaacgacggcaagtggcacacggttaagacagagtatttgaaaaga
aagggcttcgtgacagtcgacggccaggattccccgatggtgcccacggtgggagacggg
accgcgctggatgtggaagggaagctgtacctgggcggcctgccctctgactacaggccc
agggacactggacacatcacccacagcatccctgcctgcattggggaggtgacagtgaac
agcaaacagctggacaaggacagcccagtgtctgcgtttgcagtaaccaggtgctatgcg
gtggcccaggaaggaactttctttgaaggaagtggctatgcagcctttgccaaagaaggc
tacagagtcggatcagacatgaacatcaccctggagttccgtacctcctcagagaacggc
gtcctcctgggcatcagcagtgccaaagtggacgccatcggattggagattgtaaatggc
aagatcttgtttcatgttaacaatggcgctggaagggtaacagccacatacgagcccaaa
gctaccagtgctgtctgcgatgggaaatggcacacacttcaagctaacaaaagcaaacac
cgcgtggttctgatcgttgatgggaacgcagttcgtgctgaaagtccacacccgcagtct
acctcggcagacaccaacaatcccatttatgtgggtggctatcctgctgatgtgagacaa
aactgcctgagcagccagacctccttccggggctgtctgagaaagctcgcgctccttcag
ggcccgcaagtgcagtcctgtgacttcagcagagctttccaccttcaaggcgttttccct
cattcctgtcctggggctgagccctga

KEGG   Equus caballus (horse): 100060112
Entry
100060112         CDS       T01058                                 

Gene name
COL4A6
Definition
(RefSeq) collagen alpha-6(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04974  Protein digestion and absorption
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100060112 (COL4A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100060112 (COL4A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100060112 (COL4A6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100060112 (COL4A6)
  09154 Digestive system
   04974 Protein digestion and absorption
    100060112 (COL4A6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060112 (COL4A6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100060112 (COL4A6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100060112 (COL4A6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100060112 (COL4A6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100060112 (COL4A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100060112 (COL4A6)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100060112 (COL4A6)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100060112 (COL4A6)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100060112 (COL4A6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100060112
NCBI-ProteinID: XP_014584568
Ensembl: ENSECAG00000021274
VGNC: 16743
LinkDB
Position
X
AA seq 1708 aa
MHPGLWLLLVTLCLTEELAGAGEKKSYGKLCGGQDCSGGCKCFPEKGARGRPGPIGIQGP
TGPQGFAGPSGLSGLKGERGSPGPLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGEPVFAQGSFKGMKGDPGLPGLD
GVTGPQGAPGSPGAVGPIGPPGAQGPPGPPGFPGPDGNMGLGFQGEKGAKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGLQGFPGKAGLPGLPGFGITGEKGEKGIPGLPGPRG
PMGLEGVPGPPGSQGKKGASGFPGLNGFPGIKGEKGGIGLPGPDVFIDRDGAVISVPGYP
GDPGMPGLPGLKGDEGIQGPPGPSGIPGLPALPGVPGALGPQGVPGMKGDQGNPGRTTIG
AVGLPGRDGLPGLPGLPGPPGPAFETGTLQNTEPGFPGLRGERGPKGNPGLKGVKGDSGF
CACDGGVPNTGPPGEPGLPGPPGLMGLPGLKGIRGDPGSGGARGLSGARGLFGTQGPAGP
KGEKGEPTVSTGLGMPGDQGDPGPQGLPGETGAPGKDGIPGLPGLPGLLGDDGQGFPGEK
GLPGLPGDKGHSGPTGPPGIGLPGSPGPRGLPGDQGLDGLPGQQGLPGLPGDCCCKEKVG
KGDLDTKGGITLPCIIPGPYGPSGFPGTPGFPGPKGARGLPGTPGQPGLHGNKGEPGSPG
LVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGKVGSPGLPGSKGAPGDIFGAEDGAPGE
QGLQGLPGDRGFPGDSGFPGPKGLLGKSGLLGPKGERGRPGIPGLMGQPGLPGAGGLFGI
KGKPGLPGAPGFPGTSGHPGKKGPRGETGPPASAGKRGLPGLKGFPGAPGLIGFLGNSGL
PGVTGLPGLPGLKGGKGSVGLIGFPGMPGLPGIPGASGLKGVPGSPGRVGPSGRTGSPGE
KGDRGDPGPVGLPSPRLPMLNLQFKGDRGSRGSAGSNGFPGPRGDKGVAGRPGPPGLPGP
PGFPSTIKGLIGRPGLPGPTGLRGLPGLKGSPGITGFPGIPGESGSQGLNGAPGLPGASG
LPGSKGDHGQTLGISGTPGPKGQPGETGFEGVKGKAGLVGDVGFPGNKGEDGKVGLSGDV
GLPGSPGLPGIAGMRGNPGLPGTPGHPGATGPLGPPGLVGIKGFPGLPGLHGLNGLPGTK
GTHGTPGPSITGVPGPAGLPGPKGEKGPPGISMGAPGKPGMKGQKGDRGFPGLQGSAGLP
GAPGLSLPSVIAGQPGDPGRPGLDGERGRPGPQGPRGPPGPSSDQGDPGDPGFPGIPGPQ
GPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKTGPRGFSGPR
GAPGQTPIAEAIQVPPGPMGLPGIDGIPGLTGDPGLQGPVGLQGSKGLPGIPGKDGPSGL
PGPPGALGDPGLPGLQGPPGFEGAPGKQGPFGRAGMPGQSVRVGYTLVKHSQSEQVPLCP
IGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYAGRNDKSY
WLSTTAPIPMMPVGQTQIPQYISRCSVCEAPSQAIAVHSQDITIPRCPLGWRSLWIGYSF
LMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQF
REEPVSETLKAGQLHTRVSRCQVCMKSL
NT seq 5127 nt   +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctgcttgttacgttgtgcctgacagaggaactggcagga
gcgggagagaagaaatcctatggaaagctatgcgggggccaagactgcagtggaggctgt
aaatgctttcctgagaaaggagcaagagggcgaccaggaccaattggaattcaaggccca
acaggtcctcaaggatttgctggcccgagtggtttatcagggttgaaaggagaaaggggc
tccccaggccctctgggaccatacggaccaaaaggagataagggtcccatgggagttcct
ggctttcttgggatcaatgggattccgggccaccccggacagccagggcccagaggccca
cctggcctggatggctgtaatggaactcaaggagctgttggatttccaggccctgatggc
taccctgggcttctcggaccaccgggccttcctggtcagaagggctctaaaggtgaacct
gtctttgcccaaggtagtttcaaaggaatgaagggggatcctggactgcccggactggat
ggagtcactgggccacaaggagcacccggatctccaggagctgtaggacccataggacca
ccaggagcacaaggtcctccaggcccccccggtttccctggtcctgatgggaatatgggg
ttaggtttccaaggagagaaaggagccaagggggatgttggcctccctggccctgcagga
cccccaccatctactggagaactggaatttatggggtttcccaaagggaagaaaggatcc
aagggtgaaccagggcttcaaggtttcccaggaaaagccggccttccaggtctcccggga
tttggaattactggagagaaaggagaaaagggaatccctggtttgccaggacctaggggt
cccatgggtttagaaggagtcccaggtcctccagggagtcagggcaagaagggggcctca
ggtttcccagggcttaatggattcccaggaattaagggtgaaaagggtggcattggtctg
ccaggccccgatgttttcattgatagagatggtgctgtgatctcagtgccaggttatcct
ggagaccccggcatgccaggcctcccaggccttaaaggggatgaaggcatccagggcccg
cctggcccttctggcatccctggcttaccagctttaccaggtgtcccaggtgccctaggg
ccccagggagttccaggcatgaagggggatcaaggaaacccaggccgcaccacaattggg
gcagttggcctccctggcagagatggtttgccaggcctaccaggcctaccaggcccaccc
ggtccagcatttgagactggaaccctacagaacacagagccagggttccctggtctccga
ggagaacgaggtccaaaaggaaacccaggcctcaaaggagtaaaaggagactcaggtttt
tgtgcttgtgatggtggtgttcccaacactggaccacctggggagccaggcctgcctggg
ccaccaggtctcatgggcctcccaggccttaaaggaatcagaggagatccaggctctggg
ggagcacggggcctatcaggggctcgaggtttatttgggactcaaggtcctgcaggcccc
aaaggagagaagggagaaccaacggtcagtacaggattggggatgccaggagaccagggt
gatcctgggccccaggggctccctggtgagacaggagccccaggcaaggacggaatacca
ggtttaccaggtctgccaggccttctgggtgatgatggacagggcttcccaggtgaaaag
gggttaccaggacttcctggtgacaaaggccatagtggtccaaccggacccccaggaatt
gggctaccaggatcccctggacctcgcgggcttcctggagatcaaggactagatggattg
ccaggacaacaaggcctccccgggcttccaggtgactgctgctgcaaggagaaggttggt
aaaggagacttagacacaaagggaggtattaccttgccttgtattattcctgggccatat
ggtccatcaggattcccaggaactcccggattcccaggccctaaaggggcccgtggcctc
cctgggactccaggccagcctggattacatggaaataaaggagagcccggaagtccagga
ttggttcacctccctgaattgccaggatttcctggacctcgtggggagaagggcttgcct
gggtttcctgggctccctggaaaagatggcttgcctgggaaagttggcagtccaggttta
ccaggttccaagggagcccctggtgacatctttggtgctgaggatggtgctccgggggag
caaggcctacagggattaccaggggacagaggatttcctggagactctggctttccagga
cccaagggtttgcttgggaagtcaggcttgctaggccccaaaggtgaacggggcaggcct
ggaataccaggcctcatgggacaaccaggccttcccggggctggtggtctatttggcatc
aagggcaaacccggactcccaggagcaccaggctttccaggcacttcgggacatcctgga
aagaaaggtccaaggggcgagacaggtccccctgcatcagctggaaagagaggtctccct
gggctgaaaggctttcctggagctccagggctaattggcttcctggggaactcaggcttg
ccaggggtcactgggttgccaggcctgccaggtctgaagggtgggaaagggtctgttgga
ctgataggttttccagggatgccaggtctccctggtattcctggtgcaagtggattaaag
ggagttcctgggtcaccaggaagagtgggaccatctggacggactggtagccctggtgag
aaaggagacagaggcgacccagggcccgttggactacccagtccaagacttccaatgctg
aacctccaattcaaaggagacagaggctctcggggctcagctggatccaacggatttcct
gggcccagaggtgacaaaggagtagctggccgtcctgggccaccaggcttacctggacct
cctggcttccccagcaccatcaagggacttattgggagaccaggcctccctggtcccaca
ggactacggggcttacctggcctgaaggggtcccctggaatcacaggtttcccaggcata
cccggagaaagtggttcacagggtctcaatggagcgcccgggctcccaggagcatctggt
ctaccaggttcaaaaggagatcacggccagacactcggaatttccggtaccccaggaccc
aagggacaacctggggagactggttttgaaggtgtgaaaggaaaagctggactagtgggt
gatgtgggcttcccaggaaacaaaggtgaagatgggaaagttggtctttctggagatgtt
ggccttcctggctccccaggactccccgggattgcaggcatgagaggaaatccagggctt
ccgggtactccaggccatccaggggcaactgggcccctgggacctcctggcctagtagga
atcaaaggtttccctggacttcctggtttacatggactgaatgggcttccaggaacaaag
gggacccatggaactccaggacctagtataactggtgtgcctgggccagctggcctgcct
ggtcccaaaggggaaaaaggtcctccaggaatcagcatgggagccccagggaagccaggc
atgaaaggacaaaaaggtgaccgaggtttcccaggtctccagggctctgctggtctccct
ggggccccaggcctctccttgccctcagtcatagcaggacagcctggcgaccctgggcga
ccaggcctagatggagaacgaggccgaccaggcccccaggggccccgagggccccctggg
ccatcctctgatcaaggcgacccgggagaccctggcttccctggaattccgggccctcaa
gggcccaagggagaccaaggaattccaggtttctctggcctccctggagagctaggactg
aaaggcatgagaggtgagcctggcttcatggggactccaggcaaggttgggccacctgga
gacccaggatttcccgggatgaaggggaagacagggccaagaggcttttccggcccccga
ggtgctcctggacaaacaccaattgcagaagccatccaggttcctcccgggcccatgggt
ctaccgggcattgatggcatccctggcctcacaggggaccctgggcttcaaggccctgta
ggtctacaaggctctaaaggtttacctggaatccctggcaaagatggccccagcggactc
cccggccctcctggggctcttggtgaccctggtctccctggactgcaaggccctccagga
tttgaaggagctccagggaagcagggccccttcgggagggctggaatgcctgggcagagc
gtgagagtgggctacaccttggtgaagcacagccagtcggaacaggtgcccctgtgcccc
atcgggatgagccagctgtgggtgggttacagcttgctgttcgtggaggggcaggagaaa
gcccacaaccaggacctggggtttgctggctcctgtcttccccgctttagcaccatgccc
ttcatctactgcaacatcaatgaagtgtgccactatgccggacgcaacgataaatcctac
tggctctccaccaccgcccccatccccatgatgcctgtcggccagacccagattccccag
tacatcagccgctgctctgtgtgtgaggctccctcacaagccattgctgtgcacagtcag
gacatcaccatcccacggtgccccctgggttggcgcagcctctggatcgggtactccttc
ctcatgcacactgccgctggcgccgagggcggaggccagtccctggtctcacctggctcc
tgcctagaggattttcgggccactcctttcatcgagtgcagtggtgcccgaggcacctgc
cactactttgctaacaagtacagtttctggctgacaacagtggaggagaggcagcagttt
agggaggagcctgtatccgaaacgctaaaagccgggcagctccacacccgggtcagccgc
tgccaggtgtgtatgaaaagcctgtag

KEGG   Equus caballus (horse): 100060360
Entry
100060360         CDS       T01058                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100060360 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100060360 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100060360 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060360 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100060360 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100060360 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100060360 (LAMB1)
   05145 Toxoplasmosis
    100060360 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Other DBs
NCBI-GeneID: 100060360
NCBI-ProteinID: XP_023494670
Ensembl: ENSECAG00000008303
VGNC: 19565
LinkDB
Position
4
AA seq 1786 aa
MRLLQVFAFSVVALCGAQVGAQEPEFSYGCAEGSCYPATGDLLIGRARRLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICDSQDPYHDTLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFDEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEQCACNPAGSQNGGICDSYTDFSAG
LIAGQCRCKLYVEGENCDICKEGFYGLSAEEPFGCKSCACNPLGTIPGGSPCDSGTGYCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCSAESGQCACRPHMIGRQC
NEVESGYYFTTLDHYIYEAEEANFGPGVSIVERQYVQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPPSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSDVDSPYTLIDSLVLMPFCKSLDIFTVGG
SGDGLVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCKPCECHLQGSVNAFCHPVTGQC
HCFQGVYTRQCDRCLPGYWGFPSCQPCQCNGHADDCDTVTGECVSCQDYTTGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFASSCYQDPGTLQLECVCNPGYVGSRCDDCAA
GFFGNPLDVGGTCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGEHCQLCRFGYYGDA
LQQECRKCVCNSLGTVQEHCNSSECQCDKTTGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCHCDAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECRACDCDPRGIE
TPQCDQSTGQCICVEGVEGPRCDKCTRGYSGVFPDCAPCHQCFALWDVIIAELTNRTQKF
LERAKALKISGVIGPYRETVDSVEKKVSEIRDILAQSPAAEPLKNIGNLFEEAEKLTKDV
TEKMAQAEVTLADTASQSNSTAKELDALQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTDSSSTVEQSAFTRDKVEALIVEGESQFRENQEEQAGLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDDGQKKCGGPGCGGLVTVAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKLRADEAKQNAQDVLLKTNATKEKVDKSNEDL
RDLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQQSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQIAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSADDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atgaggctgctccaggtgttcgctttcagcgtcgtagccctgtgcggagcccaagtgggc
gctcaagaaccagagttcagctacggctgcgccgagggcagctgctacccggccacgggc
gaccttctcatcggccgagcacggaggctctcggtgacctcgacgtgcgggctgcacaag
cccgagccgtattgtatcgttagccacctccaggaggacaaaaaatgcttcatatgcgat
tcacaagatccttatcatgacaccctcaatcctgacagtcatctcattgaaaatgtggtc
actacatttgctccaaaccgcctgaagatttggtggcaatctgaaaatggcgtggaaaat
gtaactatccaactggatttggaagcagaattccatttcactcatctcataatgactttc
aagacgttccgcccggccgccatgctgatagagcgctcgtctgactttgggaagacgtgg
ggcgtatacagatactttgcctacgactgcgagagctcgtttccaggcatttccaccggc
cccatgaaaaaagtcgatgacataatttgtgactcccgatattctgacattgaaccctca
acagaaggagaggtgatatttcgtgctttagatcctgctttcagaatagaagatccttat
agtccaaggatacagaatctcttaaaaatcaccaacctgagaatcaagtttgtgaaacta
catactttgggagataaccttttggattccagaatggaaatcagagaaaagtattactat
gcagtttatgacatggtggttcgaggaaattgcttctgctatggccatgccagtgaatgt
gccccggtggatggattcgatgaagaagtagaaggaatggttcatggacactgcatgtgc
aggcataatacgaagggcttaaactgtgagctgtgcatggatttctaccatgacttacct
tggagaccggctgaaggtcgaaacagcaatgcctgtaaaaagtgtaactgcaacgagcat
tccagctcgtgccactttgacatggcggtgtatctggccaccggaaacgtgagcggaggc
gtgtgcgatgactgtcagcacaacacgatgggacgcaactgtgagcagtgcaaaccgttt
tacttccagcacccggagagggacatccgagacccgaacctctgtgaacaatgtgcctgc
aacccagctggctctcagaatgggggaatctgtgacagttacactgatttttcggctggt
ctcattgctggtcagtgtcggtgtaaattatacgtggaaggagaaaattgtgatatttgc
aaggaaggcttctatggtttaagtgccgaagagccctttggctgtaaatcttgtgcttgc
aatcctctgggaacgattcctggcgggagcccttgtgattccgggactggttactgctac
tgtaagcgtctggtgacaggacagcattgtgaccagtgtctgccagagcactggggctta
agcaatgatctggatggatgtcgaccttgtgactgtgaccttgggggagccttaaacaat
agctgctccgcggagtccggccagtgcgcatgtcgaccccacatgatcggacgtcagtgc
aacgaagtggaatccggttactactttaccaccttggaccactacatctatgaagcagaa
gaagccaacttcgggcctggggtcagcatcgtggagcggcagtacgtccaggaccggatt
ccttcctggactggagcgggcttcgtccgagtgcccgaaggggcttatttggagtttttc
attgacaacataccgtattccatggagtatgacatcctaatccgctatgagccacagcta
cctgaccactgggaaaaagctgtcatcacggtgcagcggcctggaaagattccacccagc
agccgatgtgggaacactattcccgatgatgacaaccaggtggtgtccttgtcgccaggc
tcgaggtatgtcgtccttccccgccccgtctgcttcgagaagggtgtgaactacaccgtg
aggttagagctgccccagtacacctcctctgatagcgacgtggacagtccctacacgctc
atcgactcgcttgttctcatgccgttctgcaagtctcttgacatcttcactgtgggaggt
tcgggagatgggctggtcaccaacagtgcctgggaaacctttcagagataccggtgtctg
gagaacagcagaagcgttgtgaagacgccgatgactgacgtttgcaggaacatcatcttc
agcatttctgccctgttacaccagacaggcctggcttgtgagtgcgaccctcagggctcc
ttaagttccgtctgcgaccccaacggaggccagtgccagtgccggccgaacgtggttgga
aggacctgcgacagatgtgctcctggcacctttggctttgggcccagtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaacgctttctgccatcccgtcactggccagtgc
cactgtttccagggggtgtacactcggcagtgtgaccggtgcttaccagggtactggggc
tttccgagttgccagccttgccagtgcaacggccatgccgatgactgtgacacagtgacg
ggggaatgcgtgagctgccaggactacaccacggggcataactgtgaaaggtgcttggct
ggttactatggtgatcccatcattgggtcgggagatcactgccgcccttgtccctgccca
gatggtcccgacagcggacgccagtttgccagtagttgttatcaagatcctggtacttta
cagcttgagtgcgtctgtaatcctggatacgttggctccagatgcgacgactgtgccgca
ggcttctttggcaatcccttggacgttggggggacgtgtcagccttgtcagtgtcaccac
aacattgacacgacagacccagaagcctgtgacaaggagaccgggagatgcctcaagtgc
ctgtatcacacggaaggggagcactgccagctctgccgattcgggtattatggagacgcc
ctccagcaggaatgtcgaaagtgtgtctgcaattccctgggcactgtgcaggagcactgt
aacagctctgagtgccagtgtgacaagaccactgggcagtgcttgtgtcttcctaatgtg
atcgggcagaactgtgaccgctgtgcgcccaacacctggcagctggccagcgggaccggg
tgtgacccgtgccactgcgatgctgctcattccttcgggccatcttgtaatgagttcacg
gggcagtgccagtgcatgcctgggttcggaggtcgcacctgcagcgagtgccaggagctc
ttctggggagaccccaacgtggagtgccgagcctgtgactgtgaccccaggggcattgag
acaccgcagtgtgaccagtccactggccagtgtatctgcgtcgagggtgttgagggccca
cgctgtgacaagtgcactcgagggtactcgggggtcttccccgactgcgctccctgccac
cagtgcttcgctctttgggacgtgatcatcgctgagttgaccaacaggactcagaagttc
ctggagagagccaaggccttgaagatcagtggtgtgatcgggccctaccgggagacggtg
gattcggtggagaagaaagtcagtgagatcagagacatcctggcccagagcccagccgcg
gagccgctgaagaacattgggaatctctttgaggaggcagagaaactaaccaaagatgtt
acggaaaagatggctcaagcagaagtgacattagctgacacagcttcacaaagcaacagc
acagccaaagaactagacgctctacagacagaagcagagagtctagacaacacagtgaag
gagcttgctgaacaactggaatttatcaaaaactcagatattcggggcgccctggatagc
atcaccaagtatttccagatgtctctggaggcagaggagagggtgaatgcctccaccacg
gattccagcagcaccgtggagcagtcggctttcactcgagacaaagtggaagccttgata
gtcgagggggagtcccagttcagggaaaaccaagaggaacaggccggccttctggatgag
ctggccgggaaactacaaagcctagacctttcagctgccgccgaaatgacctgcggcacg
cctccgggggcctcctgttctgagacggagtgtggcggcccaaactgcagaactgatgac
ggacagaagaagtgtggggggcctggctgtggcggtctggtcactgttgcacacagtgcc
tggcagaaagccatggactttgaccgagatgtcctcagcgccctggctgaggtggaacag
ctctccaagatggtctctgaagcaaaactgagggcagatgaagcaaaacaaaatgctcaa
gatgttctgttgaaaaccaacgctaccaaagaaaaagtggacaagagcaatgaggacctg
agagatctcatcaagcagatcaggaactttctgactcaggatagtgctgacttggacagc
attgaagcagttgctaacgaagtattgaaaatggaaatgcctagcaccccacagcagtta
cagaacctgacagaagatattcgtgaacgagttgaaagcctttctcaagtagaggttatt
ttacagcaaagtgctgccgacattgccagagctgagatgttgttagaagaagctaaaaga
gccagcaaaagtgcaacagacgttaaagtcaccgcagacatggtgaaggaagctctggaa
gaagcggagaaggcccagattgctgcagagaaggcaatcaagcaggcggatgaagacatc
caaggaacccagaacctgctgacttccatcgagtctgaaacagcagcttctgaggaaacc
ttgttcaacgcctcccagcgcatcagcgagctggagaggaatgtggaagaacttaaacgg
aaggctgcccagaactctggggaggcagaatatattgaaaaagttgtatataccgtaaaa
caaagtgcagatgatgttaagaagactctggatggcgaacttgatgaaaagtataaaaaa
gtagaaaatttaattgccaaaaaaaccgaagagtcagctgatgccagaaggaaagctgaa
atgctacaaaatgaagcaaaaacacttttggctcaagcaaacagcaagctgcaactcctg
aaagatttagaaagaaaatatgaggacaatcaaaaatatttagaagataaagctcaagaa
ttagtaagattggaaggagaggtccgctcactcctaaaggatataagccagaaagtcgct
gtgtatagcacctgcctgtaa

KEGG   Equus caballus (horse): 100060434
Entry
100060434         CDS       T01058                                 

Gene name
LAMB4
Definition
(RefSeq) laminin subunit beta-4 isoform X1
  KO
K06245  laminin, beta 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100060434 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100060434 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100060434 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060434 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100060434 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100060434 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100060434 (LAMB4)
   05145 Toxoplasmosis
    100060434 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 100060434
NCBI-ProteinID: XP_023494671
LinkDB
Position
4
AA seq 1791 aa
MQFQLTFFLHLGLLSYAKAQDECHRGACHPTTGNLLVGRGAQLTASSTCGLDGAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVITSFEPDREKKWWQSENGLDHVSIRLDL
EALFQFSHLILTFKTFRPAAMLVERSTDYGHTWKVLKYFSKDCAASFPNVTSGQAQGVGD
LVCDSKYSDIEPSTGGEVVLKVLDPSFEIEDPYSPHIQDLVTLTNLRINFTKLHTLGDTL
LGRRENDSLDKYYYALYEMVVRGSCFCNGHASECGPMQTVRGDVFSPPGMVHGRCVCQHN
TDGPNCERCKDFFQDAPWRPAAGLQDSTCRACSCNGHSDRCHFNSTVYLASGGLSGGVCE
DCQHNTEGQHCHRCRPLFYRDPLKAISDPYACIPCECDPDGTISGGICVSHSDPAVGSVA
GQCLCKDNVQGAKCDQCQPNHYGLSAADPLGCQPCDCHPHGSLPLSPCDVDTGQCLCQPS
ATGPRCDECAVGYWGLENHLHGCSPCDCDIGGAYSNVCSPKDGQCECRPHITGRSCTEPA
PGYFFAPLNFYLYEAEEAMPLQGLAPLILATALPTCDVYFRQQGNDFIIDKGNIILKRNQ
KQSLRADKPSEGSATFGQVPADHGVFPEPVPGSPVTWTGPGFARVLPGAGLRFTVNNIPS
AMDFAVAIRYETQSADDWAVQIMVNPPRGSKHCTRKTPWPKPQSFALPAASRIVLLPTPI
CLEPDVQYSIDVYFSQPLEGRSHAHSHILVDSLGLIPQINSLENFCSEQDLDEYQLHNCV
EIASEARPRVLPSACERLIVSVSARLHEGAVACKCHPQGSVGPSCSRLGGQCQCKPHVAG
RCCDRCSAGSYGLGHHGCHSCHCHPEGSKSIVCDQITGQCPCQGEVAGRRCDRCLAGYFG
FPNCRPCLCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYGNPSSGQSCRPCPCPDV
PSSNQYFAHSCYQNPWGSDVICDCLQGYTGKQCEECSAGFYGNPRISGAPCQPCACNNNI
DLSDPDSCSRVTGECLRCLHNTHGPNCQLCKPGHFGSAINQTCRRCSCHPSGVNPAECRP
DQGACLCDPDTGTCPCLPNVTGQACDHCADGYWNMIPGRGCQPCDCDPQTSHSRHCDQVT
GQCLCKLGYDGKRCSECKENYYGDPQGRCIPCDCNQEGTQKPVCDQATGMCRCQEGVSGP
RCDRCARGHNQEFPACLPCHSCFDQWDHTISSLSKAVQGLIRLAATMDDKRETLPACEAD
FKDLTENMSEIERILKHPVFSSGEFLKVKDYHDSVRKQIEQLSGQLKTVYEFQDLKETTE
RMRNEADLLLADLQEEIDLRSGARNASIVDSLESIKKYYQSSSYAEKETNETTLIISNSE
KTRNDLLTNLDTLTSKGNLSREKLKQIKIPDIQILNEKVCGERGGAPCVVSACGDPRCHG
SLTLSRDALQKAQEAESTTHNLSNQFQGLKNQIKNISKLAEVSKNNALQLSEKLRNMKNQ
SESEEEKLNLLIKKLKKFLLEENVPPEDIEKVANRVLDIRLPVTSQNLTHELDKIRKLTQ
LCEDYRADENRLNKAAEGARKVLVKAKGAKKAAHVLLNLDKMSNTLQQVRITQGRANSTI
TQLTAEITKLKKNVLQAENQAKETKNELHLAKQQSALEDGLSQLWTKLQRNRDQASRVKA
QAESARRQAGGLEEEFVELKNQYAVLQRKTSATGLTKETVGKVKQLKDAAEKLAGDAEDK
IRRITDLEKKIQDLNLSRQEKADQLKQLEDQVIAIKNEIVEQENKYATCYS
NT seq 5376 nt   +upstreamnt  +downstreamnt
atgcaatttcaactgaccttttttctgcaccttgggttgctcagttacgcgaaggctcaa
gatgaatgccataggggtgcctgtcatcccaccaccggcaatctcttagtgggccgcggt
gcacagctcacggcttcttctacctgtgggctggatggagcccagaaatattgcatcctc
agctacctcgagggggaacaaaaatgcttcatctgtgactccagatttccatatgatcca
tatgcccaacccaacagccacaccattgagaacgtaattacaagttttgaaccagataga
gaaaagaaatggtggcaatctgaaaatggtcttgatcatgtcagcatcagattggaccta
gaggcattatttcagttcagccacctgattctgacctttaagacttttcgacctgctgca
atgttagttgaacgctccacagactacggacacacctggaaagtgttaaaatatttttca
aaggactgtgctgcttcctttcccaacgtcacatctggccaggcccagggagtgggagac
cttgtttgtgactccaaatattcggatattgaaccctcaactggtggtgaggttgtttta
aaagttttggatcccagctttgaaatagaagatccttacagcccccacatccaggacctt
gtgacattaacaaacctgaggataaactttaccaaactccatacccttggggacaccttg
cttggaaggagggaaaatgattccctcgataaatactactatgctttgtatgagatggtg
gttcggggaagctgtttttgcaatggccacgctagtgaatgcggcccgatgcagacggtg
aggggagatgttttcagccctccgggaatggttcacgggcggtgtgtctgtcagcacaat
accgacggccccaactgtgagaggtgcaaggacttcttccaggacgctccgtggaggcca
gccgcaggcctccaggacagcacttgcagagcttgcagctgtaacggccactcggaccgc
tgtcacttcaacagcaccgtgtacctggcgagcggcggcctcagcgggggcgtgtgtgaa
gactgccagcacaacaccgaggggcaacattgccatcgctgcagaccccttttctacagg
gaccccctcaaggccatctcggatccctacgcgtgcatcccttgtgaatgtgatcctgac
gggaccatatcgggtggcatttgcgtgagccactctgaccctgccgtggggtctgtggcc
ggccagtgcttgtgtaaggacaacgtgcaaggagccaagtgcgaccagtgccagcccaac
cactacggactgagcgccgccgaccccctgggctgtcagccctgcgactgtcacccacac
gggagtctgccactctcgccctgcgatgtggatacaggccaatgcttgtgccagccgtct
gccaccggaccacgctgtgatgaatgcgctgttggatactgggggctggaaaatcacctc
cacggatgttctccctgcgactgtgatattggaggggcctattcgaacgtgtgctcaccc
aaggacgggcagtgtgaatgccgcccgcacatcactggccgcagctgcactgaaccagcc
cccggctacttctttgctcctttgaacttctatctctatgaggcagaggaagccatgcca
ctgcaaggacttgcgcccttgatattagcaacagctttgcctacatgtgatgtgtatttc
cggcaacaaggaaatgatttcataattgacaaaggaaacataatactgaagagaaatcag
aaacaaagcctacgtgcagacaagccgagtgagggctcggcgactttcggccaggtgcct
gctgatcacggtgttttcccagagccggttcctgggagccctgttacctggactgggcct
ggatttgccagggttctccctggggctggcttgagatttacagtcaacaacattccctct
gccatggacttcgctgttgccattcgctatgaaactcagtccgcagatgactgggctgtc
cagatcatggtcaacccccccagagggagcaagcactgtacacgcaagaccccatggccg
aagcctcagtcttttgccttaccagcggcttccagaatcgtgctgcttcccacacccatc
tgtttagaaccagatgtacaatattccatagatgtctacttttcccagcctttggaagga
aggtcccacgctcattcacacattctagttgactctcttggtcttattccccaaatcaat
tcactggagaatttctgcagcgagcaggatttagatgaatatcagctgcacaactgtgtt
gaaattgcctcagaagcaagacctcgggtgctcccttctgcgtgtgaaaggctcatagtc
agcgtgtctgccaggctgcacgagggggcagtggcctgcaagtgtcacccccagggctca
gtggggcccagctgcagccgacttggaggccagtgccagtgtaagcctcatgtggccggg
cgctgctgtgacaggtgctcagcaggaagctacggtttggggcatcatggctgtcactca
tgtcactgccaccctgaaggctcaaagagcattgtgtgtgaccaaataacaggacagtgc
ccctgccagggagaggtggctggccgccgctgcgatcgatgcctggcgggctattttgga
ttccccaactgccgtccttgcctttgcaatgggttcgctgaactttgtgatccagagaca
gggtcgtgcttcaactgcggaggttttacaactggaagaaactgtgaaaggtgcatcgat
gggtactatggaaatccttcttcaggacagtcctgccgtccttgcccatgtcctgatgtt
ccctctagcaatcagtattttgcccattcctgttatcagaatccttggggctcagatgta
atctgcgattgtcttcaaggttatacaggtaagcagtgtgaagaatgctctgctggtttc
tacggaaatccaagaatttccggagcaccttgccagccgtgtgcctgcaacaacaacatt
gatctaagtgatccagattcctgtagccgggtgacaggggagtgcctcagatgtctgcac
aacactcatggacccaactgccagctctgcaaaccgggtcactttggatcggccatcaat
cagacctgcagaagatgctcctgccatccttccggcgtgaatcctgctgagtgtcgccct
gaccagggagcttgcctctgtgaccctgacactggcacatgcccttgtctgcccaacgtc
acaggccaggcctgtgaccattgtgctgatggatactggaatatgatccccggcagagga
tgtcagccatgtgattgtgacccccagacctctcacagcaggcactgtgaccaggttacg
ggccagtgtctgtgtaaattaggctatgatgggaaacgctgcagtgagtgcaaggaaaat
tattacggtgacccacaggggcgatgcattccatgtgactgcaaccaggaaggtacccag
aagcccgtctgtgaccaggccacgggcatgtgccgctgccaggagggtgttagcggcccg
cgatgtgatcgctgtgcccggggtcacaaccaggagttccctgcttgtcttccgtgtcac
tcgtgctttgatcaatgggaccacaccatttcttccctctccaaagcagtgcaagggtta
attaggctggctgctaccatggacgataaaagagagaccctgcctgcctgtgaggccgac
ttcaaagacctcacagagaacatgtccgaaatagaaaggattttgaaacatcctgttttc
tcatctggggaattcttaaaagtcaaggattatcatgactccgttcggaaacaaatcgag
cagctaagtgggcagctgaaaacagtgtatgagtttcaagatctgaaagaaacaacagaa
agaatgaggaacgaagctgacctcttacttgcagatctgcaggaagaaattgatttgcgc
tctggtgcccgtaatgcaagcatcgtggattccttagagagcatcaagaaatattatcag
agttcatcgtatgctgaaaaggaaactaatgaaactactctcatcataagtaactctgaa
aaaaccaggaatgacttacttaccaacttagatacactaacctcaaaaggaaacttgtca
cgggaaaaattaaagcagattaagataccagatatccaaatattgaacgaaaaggtgtgt
ggagaacgagggggtgcaccgtgtgtggtctcagcttgtggtgacccccgctgtcacggc
tccctgaccctctccagggacgctctccagaaagctcaggaagcagagtccacgactcat
aatttgagcaatcagtttcaagggttgaagaatcagatcaaaaatataagtaaactggca
gaagtctccaagaacaatgccttacagctaagtgagaaactgaggaatatgaaaaaccaa
agtgaatctgaagaagaaaaactgaatcttttaatcaaaaaactgaaaaagtttttgtta
gaggaaaacgtgcctccagaggacatagagaaggttgcaaatcgtgtactcgacatccgc
ctaccagtaacatcacaaaatctaacccatgaacttgacaaaatacggaaacttacacaa
ctctgtgaggactacagggcagacgagaacaggctaaataaagcagcagagggagcccga
aaggttttggtgaaggcaaaaggagccaaaaaagcagcccatgttctattaaatctcgac
aaaatgtcgaatacgttgcaacaagttcgaatcactcaaggacgggcaaattccaccatc
acacagctgacggccgagataacaaaattaaaaaagaacgtgctgcaggctgaaaatcaa
gccaaggagactaagaatgagctgcacttagcgaagcaacagtcagccttagaggatgga
ctttcccagctgtggaccaagttacagaggaatcgagaccaagccagccgtgtgaaagct
caggcggagtcagcccgacgccaggctgggggccttgaggaggagtttgttgagctaaaa
aatcaatatgctgttcttcaacgtaagacaagcgctacaggactgacaaaggaaacagta
ggaaaagtgaaacaactaaaagatgctgcagaaaaattggctggagatgcagaggacaag
ataagaagaataacagatttagaaaagaagatccaagatttgaatctaagtagacaagaa
aaagctgatcaactgaaacagttggaagatcaagtcattgccattaaaaatgaaattgtt
gagcaagaaaataaatatgctacctgctatagttag

KEGG   Equus caballus (horse): 100062160
Entry
100062160         CDS       T01058                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04974  Protein digestion and absorption
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100062160 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100062160 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100062160 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100062160 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    100062160 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062160 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100062160 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100062160 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100062160 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100062160 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100062160 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100062160 (COL4A4)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100062160 (COL4A4)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100062160 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100062160
NCBI-ProteinID: XP_023498216
Ensembl: ENSECAG00000011138
VGNC: 16741
LinkDB
Position
6
AA seq 1686 aa
MAFIRCSFRWTKPLAIDPWSLILILFSVQHVYGSGKKFIGPCGGRDCSACRCFPEKGSRG
QPGLPGLQGPIGPLGPPGPIGIPGEKGRRGDSGPPGAAGDKGDKGPTGVPGFPGLDGIPG
HPGPPGPRGTPGINGYNGSRGDPGLPGERGAPGPGGPPGLPGANGEKGNSVFIFGAIKGI
QGDRGDPGPPGLPGSRGSRGPVGPVGYPGAPGLTGPPGHPGSPGLKGNPGVGVKGQMGDP
GEIGQQGSPGPTLLVQPPDFSLYKGEKGIKGMPGMIGPPGPPGPKGVPGTGEKGEKGVPG
FPGPRGNPGSYGSPGFPGLKGEPGLSGEPGPFGFLGPKGDPGYRGDPGPPGVLTTPSLPL
KGPPGDPGFPGRHGEVGAIGPPGPPGHSGSPGEACAGMMGPPGPRGFPGHPGFPGAAGIP
GRADSAPGKSGNPGPPGLPGAPGRQGPPGSDAIYCTAGHPGPQGMKGKVGPPGRRGSKGE
KGSMGLCACQPGPMGPPGPPGLPGRQGSKGDLGLPGWLGEKGYPGPPGAEGSPGPPGKPG
ASGLPGSKGEKGDMVVSRVKGRKGERGPDGPPGFPGQQGQHGRDGRAGEKGDPGPPGDHE
AAAPGDRGFPGPPGPPGRAGPRGPPGLGFPGLPGQRGPPGAPGRPGSRGPEGVKGQKGDT
IPCNVTYPGRPGPPGFDGPPGPKGFPGPRGAPGLRCLDGVKGQRGQPGLSEIPGPPGFRG
DIGDPGLRGEKGSSPVGPPGSPGSPGVNGQKGIPGDPAYGHPGPPGRRGPSGMPGLKGLR
GDPGRPGAAGPAGMPGFPGLKGPKGREGSAGFPGIPGPPGHSCERGAPGIPGQPGLPGAP
GSPGAPGWKGQRGDVGPPGPAGMKGLPGVPGRPGADGPLGPPGVPGPFGDDGLPGLPGPK
GLQGLPGFPGFPGERGKPGPEGQPGRKGEIGEKGWPGFLGDPGLRGAKGSRGPPGDEGEV
VIIPRKGETGDPGPPGDGGFPGEGGDKGNPGMQGSRGEPGRHGPPGFHRGEPGRNGQPGL
PGPPGPPGSPGLRGIIGFPGFPGDQGQPGSPGPPGLSGVDGRRGPKGNKGDLASQFGPPG
PNGEPGSPGCPGHFGAPGEQGLPGVQGSRGPPGRPGLPGSSGPPGCPGNQGVPGLEGHPG
EMGDPGPRGLMGDPGTPGLPGIKGPPGSPGLNGLHGLKGQKGSEGASGLHEVGPRGPVGI
PGLKGETGDPGSPGISPPGLFGEKGPPGPPGRPGPPGPAGATGRAPTGDIPDSGPPGDQG
PPGPDGLRGTPGPPGPPGSVDLLRGEPGDRGLPGPPGPPGPPGPPGHKGFPGCDGKDGQK
GPMGFPGPPGPPGLPGPPGEKGLLGPPGRQGPSGPPGSRGEPGPPADVDSCPRIPGLPGV
PGPRGPEGEMGPPGMRGPPGPGCKGEPGLDGRRGEDGIPGSPGPPGHKGDMGEAGCPGAP
GPPGPTGDPGPKGLGPGYLSGFLLVLHSQTDGEPTCPVGMPKLWTGYSLLYLEGQEKAHN
QDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEEIRPYIS
RCAVCEAPAQAVAVHSQDQSIPACPRTWKSLWIGYSFLMHTGAGDQGGGQALMSPGSCLE
DFRAAPFLECQGRQGTCHFFANEYSFWLTTVKPDLEFSSAPSPDTLKESQAQRQKISRCQ
VCLKYG
NT seq 5061 nt   +upstreamnt  +downstreamnt
atggcatttataagatgctctttcaggtggaccaagcccttggccatagatccctggtca
cttatactcattctcttttctgtacaacatgtgtatgggagcggaaagaagtttattggt
ccttgtggaggaagagattgctctgcttgccggtgttttcctgaaaaggggtctaggggt
caacccggactcccagggttgcagggccctattggacccctgggacctccaggacccatt
ggaattccaggagagaaagggaggagaggtgacagtggccctcctggagcagcaggtgac
aaaggagataagggtccaactggtgtccccggatttccaggtttagacggcatacctggg
cacccaggccctcctggacccagaggcacacctggcataaatggctacaatggctcaaga
ggtgatccagggcttccaggagaaagaggcgctcctggcccaggaggccccccaggcctt
cctggggcaaatggagaaaaaggaaattcagtcttcatttttggtgccattaaaggtatt
cagggtgacagaggggacccaggacctcctggcttaccaggatcaaggggctccagagga
ccagtgggcccagtgggatatccgggagcgccggggttaacaggacctccgggccatcct
gggagtccaggtttgaagggtaatcctggcgtgggagtaaaggggcaaatgggagacccg
ggtgagattggccagcaaggttctccgggacccaccctgttggtacagccacctgatttt
agtctctataaaggagaaaagggtataaaaggaatgcctggaatgattggacctccggga
cctcctggacccaagggagtccctggtactggagaaaaaggagagaaaggtgttcctggg
tttccaggacctcggggtaaccctggttcctatggatctccaggttttccaggattaaag
ggggaaccaggactgtctggagagcctgggccatttggatttcttggtccaaagggggat
cctggatatcgcggggacccagggccaccaggtgttttgacaactccctctcttccactg
aaaggccctccaggggatccagggtttcctggccgccatggagaagtgggggctattgga
ccacctggtccccctggtcactcaggtagcccaggggaagcctgtgcaggcatgatggga
ccccctgggccacgagggtttcctggtcatccaggatttccaggggcagctggtattcct
gggagagctgattctgctccaggaaagtcagggaacccgggaccacctgggttgcctgga
gcaccagggcggcagggacctccaggatcagacgctatatattgtactgctgggcaccct
ggaccacaaggaatgaaaggcaaagtgggtcctccaggaagaagaggctcaaaaggtgaa
aaaggaagcatggggctctgtgcctgccagcccggtcccatgggcccaccaggccctcca
ggacttcctgggaggcagggtagtaagggagacttgggcctccctgggtggcttggagaa
aaaggttacccaggccctcctggtgcagaaggatctccagggccaccaggaaaacctggt
gcttcaggactacctggcagcaaaggagaaaagggcgacatggttgtatcaagagttaaa
gggcgcaaaggagaaagaggtcctgatgggcccccaggatttccaggacagcaaggacaa
catggtcgggatggtcgcgctggagaaaaaggggatccaggacccccaggggatcatgaa
gctgcagccccaggtgatcgagggtttcctggaccgccgggcccacctggcagagcagga
cctaggggtcctccaggactgggatttcctggtctaccgggacagagagggccaccagga
gctccaggccgcccgggcagcaggggccctgagggcgtgaagggtcagaaaggtgataca
attccttgtaacgtaacctacccagggaggccaggccctccaggctttgatggacctcca
ggtccaaagggatttccaggtcctcggggcgctcctgggctgaggtgtttggatggggtt
aaaggtcagcgtggccaaccaggactatcagaaatacctggtccacctggctttcgtggt
gacataggcgatccaggtcttagaggtgaaaaggggtcctcccctgtggggcccccaggc
tctccagggtcacctggggtgaatggtcagaaaggaattcccggagaccctgcttatggc
cacccaggacccccgggaaggaggggtccttcagggatgccagggttgaaaggactcaga
ggtgatccaggacgtccaggagctgcagggccagctggcatgcccggattcccgggtctc
aaaggtcccaaaggcagagagggaagtgctgggtttccaggtatcccaggtccacctggc
cattcctgtgaaagaggcgctccagggatcccagggcaaccgggcctccctggggctcca
ggcagtccaggtgccccaggttggaaaggacagcgaggggatgtggggcctcctggacca
gctggaatgaagggcctccctggagtcccgggacggcctggggcagacggacccctggga
ccaccaggagtcccaggcccctttggggatgatggactacctggccttccaggcccaaag
ggactccaggggctgcctggcttcccagggtttccaggagagagaggaaagcctggtcca
gagggacaacctggccgaaagggagaaattggagagaagggttggcctggcttcctggga
gacccgggactgagaggagccaaaggatcgagaggacccccaggagatgaaggagaagtg
gttataattcccagaaagggggaaaccggggatcctggacctcctggagatggtggattc
ccaggagaaggaggtgataaaggcaatcctgggatgcaagggagcagaggagagccggga
agacacggaccacctggatttcacagaggagagcctggtagaaatgggcagccggggctt
cctggacccccaggccctccaggctccccggggctgagagggatcattggttttccagga
tttccaggtgaccagggtcagccgggttctccagggccccctggactttcaggagttgat
ggaaggagaggacctaaaggaaacaaaggtgaccttgcaagtcagtttggcccccctggt
ccaaatggtgagccaggtagccctggatgtccaggacattttggagctcctggagagcag
ggcttgcctggtgttcaaggatccaggggaccacctggaagaccaggactgcctggctcc
tctggaccaccagggtgtccaggtaatcaaggggtgcctgggctggaaggacatccagga
gagatgggggatcctgggccaagaggcctcatgggggatccagggacaccaggtcttccg
ggaataaaaggtcccccagggtcacccggcctgaatggcttgcatggtttaaagggtcag
aaaggaagcgaaggcgcttcaggtttgcatgaagtgggtccacgcggcccagtgggaata
cctgggctgaaaggggagacgggagaccccgggagcccaggaatttctcctccagggctt
tttggagaaaaaggtcctccagggcccccagggagacctggaccacctggccctgcaggt
gccacaggaagagctcctacgggtgacattcctgactcgggtccacctggagatcaggga
cctcctggccccgatggtctgagaggaacacctgggcctcccggcccccctgggagtgtc
gaccttctgagaggggaaccaggtgaccgtggtcttccagggccaccaggtcccccaggc
cccccaggccctccaggacacaaaggcttcccagggtgtgatggaaaagacggccagaaa
ggacccatgggattcccggggccgccggggccacctggacttcctgggccacctggagag
aagggtttgctgggacctccagggagacaggggccctctggccctccgggttccagaggt
gaacctgggccacctgcagatgtggattcctgcccccgaatcccggggcttcctggggta
ccaggcccaagaggcccagaaggagagatggggccccctggaatgaggggccccccagga
ccagggtgcaaaggagagcctgggctggatggcaggaggggcgaggatggcatccctggg
tctcccgggcctccaggacacaaaggtgacatgggagaagctggctgccctggagcacca
ggccctcctgggcccactggggatcctgggcccaaagggcttggccctggatacctcagt
ggcttcctcctggttctccacagtcagacagatggagagcccacctgccccgtgggcatg
cccaagctctggacgggctatagtctgttatacctggaagggcaggagaaagctcacaat
caagacctcggcctggcgggatcttgccttcctgtgtttagtacactgccctttgcctac
tgcaacatccaccaagtgtgccactatgcccagagaaatgacagatcctattggctggcc
agcgctgcacccctgcccatgatgccactctcggaagaggagatccgcccctacatcagc
cgctgtgctgtgtgtgaggccccggctcaggcggtggcggtgcacagccaggaccagtcc
atccccgcgtgtccgcggacctggaagagcctttggatcgggtactcattcctgatgcac
acaggagctggggaccaaggaggagggcaggccctcatgtcacctggcagctgcctggag
gacttcagagcggcaccattccttgaatgccaaggccggcagggcacttgccactttttt
gcaaatgagtatagcttctggctgacaacagtgaaacccgacttggagttctcctcggca
ccatcaccagacaccttaaaagaaagccaggcccagcgccagaaaatcagcaggtgccag
gtctgtctgaagtatggctag

KEGG   Equus caballus (horse): 100066148
Entry
100066148         CDS       T01058                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04974  Protein digestion and absorption
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100066148 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100066148 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100066148 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100066148 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100066148 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100066148 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100066148 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100066148 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100066148 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100066148 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100066148 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100066148 (COL4A1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100066148 (COL4A1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100066148 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100066148
NCBI-ProteinID: XP_023477594
Ensembl: ENSECAG00000019838
VGNC: 16738
LinkDB
Position
17
AA seq 1669 aa
MGPRLGVWLLLLPAALLLHEERSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFTGTPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGP
PGTPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGEKGDQGVSGPP
GVPGQAQVKEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGEKGEKGS
TGFPGDSGYPGLPGREGFKGDKGEAGPPGPPGIVIGTGPLGEKGERGFPGTPGLRGEPGP
KGFPGLQGQPGPPGFPVPGQPGAPGFPGERGEKGDQGFPGRSLPGPSGRDGLQGPPGPPG
PPGRPGHTNGIVECQPGPPGDQGPPGIPGQPGLTGEVGEKGQKGESCLICDSTGLRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGAPGLMGQPGAKGEPGEIYFDIRLK
GDKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDI
GPPGPPGFGPIGPIGDKGQAGFPGSPGSPGLPGPKGEAGKVVPLPGPPGAEGLPGSPGFQ
GPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDVGPPGNPGRQGFSG
LPGSPGVPGQKGEPGIGLPGLKGSPGIPGIPGTPGEKGSIGGPGIPGEHGAIGPPGLQGI
RGDPGPPGLQGPKGAPGVPGIGPPGVMGPPGGQGPPGSSGPPGVKGEKGFPGFPGLDMPG
PKGDKGTQGLPGLTGQSGLPGLPGQQGTPGLPGFPGPKGEMGVMGTPGQPGSPGPAGVPG
LPGEKGDHGFPGSSGPRGDPGFKGDKGDVGLPGKPGSMDKVDMGSMKGEKGDQGEKGQIG
PTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGVGGTPGAPGLPGPKGSVGGMGLPG
TPGEKGVPGIPGPQGVPGLPGEKGAKGEKGQAGLPGIGIPGRPGDKGDQGLAGFPGTPGE
KGEKGSAGIPGMPGSPGPKGLPGSVGYPGSPGLPGEKGDKGLPGLDGIPGIKGEAGLPGK
PGPSGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGTKGEKGSKGDVGFPGLAGSP
GIPGSKGEPGFLGPPGPQGQPGLPGAPGHAVEGPKGDRGPQGQPGLPGLPGPMGPPGLPG
LDGLKGDKGNPGWPGAPGAPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGQKG
LPGLQGVKGDQGDQGFPGTKGLPGPPGPPGPYDIIKGEPGLPGPEGPAGLKGLQGPPGPK
GQQGVTGLVGLPGPPGIPGFDGAPGQKGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTIDDPQCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPQCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggccccggctcggcgtctggctcctgctgctgcccgccgccctcctgctccatgag
gagcgcagccgggccgctgcgaagggtggttgtgctggctctggctgcggaaagtgtgac
tgtcatggagtgaagggacaaaagggtgaaagaggcctcccagggttacaaggtgtcatt
gggtttccgggaatgcaaggacctgaggggccgcagggaccaccaggacaaaagggtgac
actggagaaccaggactgccaggaacaaaagggacgagagggcccccaggagcatcgggt
taccctggaaacccaggacttcctggtattcctggccaagatggtcccccgggcccccca
ggtatcccaggatgcaatgggacaaagggtgagagaggacctctggggcctcccggtctg
cctggattcactgggactccgggaccaccagggttacctggaatgaagggggacccaggt
gagatactcggccacgtgcccgggaccctgttgaaaggggaaagaggattccctggaccc
ccaggaacaccaggttcgccaggattgccagggctgcaaggtcccgttggccctccagga
tttaccggaccaccaggtcctccaggccctcctggccctccgggtgaaaaggggcaaatg
ggcttaagttttcaaggaccaaaaggcgagaagggtgatcaaggggtcagtgggcctcca
ggagtgccaggacaagctcaagtcaaagaaaaaggagactttgccactaaaggagagaag
ggtcaaaaaggtgaacctggatttcagggaatgccaggggttggagagaaaggcgaacct
ggaaaaccggggccccgaggaaaacctggaaaagatggtgaaaaaggagaaaaagggagt
acagggtttcccggcgactcagggtacccaggactcccgggccgagagggttttaaggga
gacaaaggggaagcaggcccccccggcccgcctggaattgttattggcacaggaccattg
ggagaaaaaggagagcggggcttcccagggactccagggttgagaggagagccaggtccc
aagggtttcccaggattacaaggccagccaggccctccaggcttcccagtaccagggcag
cctggtgctcctggcttccctggagaaagaggagaaaaaggggaccaaggatttccaggc
cggtctttgccaggaccaagtggaagggatgggcttcagggtcctcctgggccccccgga
ccccctggacggccaggccacacgaatggaattgtggagtgccagcctggaccacccggg
gatcagggtcctcctggaattccggggcagccgggattgaccggggaagtcggagaaaaa
ggtcaaaaaggagagagttgcctcatctgtgactcaacaggacttcgtggccccccaggg
ccccagggaccccctggggaaataggtttcccaggacagccaggggccaagggcgacaga
ggcttacctggcagggatggtcttgaaggattgcctggcccacaaggtgcacccgggctg
atgggccagccaggagccaagggagagcctggtgagatttactttgacattcgactcaaa
ggtgacaaaggagacccaggttttccaggacaacccggtatgccaggcagagcaggatct
cccggaagagatggccatccaggtctgcccggccccaaaggctctccgggttcagtagga
ttaaaaggagaacgtggcccccctggaggcgttggatttcccggcagtcgtggtgacatt
ggccctcctgggcccccagggtttggccctattggccccattggtgacaaaggacaagcg
ggctttccgggaagccctggatcccccggcctgccaggtcccaagggtgaagcaggaaaa
gtcgtgcccttacctggtcctcctggagcagaaggacttccggggtccccaggtttccaa
ggcccccaaggtgaccgaggttttcctggaaccccaggaaggccgggcctcccaggagag
aagggtgctgttggccagcccgggattgggtttccaggccctcctggccccaaaggtgtt
gatggcttacctggagatgtgggacctcctgggaatccgggtcgccaaggatttagtggc
ctacctggctctccaggtgtgccaggccaaaagggagagcctggtataggtctgccagga
ctcaaaggatcgccaggtattcccggcattcctggcactcctggggagaagggaagcatc
gggggaccaggcattcccggagagcatggagctatcggccccccaggccttcagggaatc
agaggtgacccaggacctcctggattacaaggtcccaaaggagctccaggagttcccgga
ataggtccccccggagtgatgggtccccctggaggacaaggaccaccagggtcatcaggc
cctcccggagtgaaaggagagaagggtttccctggattcccaggcctggacatgccgggc
cccaaaggcgacaaagggactcagggtctgcccggcctcactgggcagtcggggctgcct
ggtcttcccggacagcaggggacgcccgggcttcccgggtttccaggtcccaagggagag
atgggcgtcatggggaccccggggcagcccggctcaccaggaccagcaggcgtgccagga
ttgccgggtgaaaaaggggaccacggcttcccaggctcctcgggacccaggggagaccct
ggcttcaagggcgataaaggagatgtcggcctccctggcaagcctgggtccatggataaa
gtggacatgggcagcatgaagggagagaagggagaccaaggagaaaaaggacaaattgga
ccaactggtgataaaggatcccggggagatcctggaaccccaggagttcctggaaaggac
ggccaagcaggacaccctgggcagccaggacctaaaggtgatccaggtgtaggtggaacc
ccgggtgctccgggccttcccggccccaaaggatcggtcggtggaatgggcctgccagga
acccctggagagaagggtgtgcctggaatccccggcccgcagggcgtccctggcttacct
ggagagaaaggagccaaaggagagaaagggcaggcgggtctccctggcattgggattccg
ggacggcccggggacaagggagaccaagggctggcaggctttccgggaactcctggagag
aagggcgagaagggaagtgctgggatcccgggcatgcccggctccccaggccccaaaggc
ctgccggggagcgtgggctatccaggaagccctgggttgcctggagaaaaaggtgataaa
ggcctcccagggttggacggcatccctggtatcaaaggagaagcaggtcttcctgggaag
cctggcccctcgggcccagccggccagaaaggggagcctggcagtgatggaatcccgggg
tcagcaggagagaagggtgaaccaggtctacccggaagaggattcccagggtttccaggg
accaaaggagagaaaggttcaaagggtgacgtgggtttcccaggattggctgggagtcca
ggaatacctggatccaaaggagagccggggttcttgggacctccggggccacaaggacag
ccaggattgcctggagctccgggccacgctgtggaggggcccaaaggagaccggggccca
cagggacaacctggcctgccaggccttccgggacccatggggccgccggggctccccggg
cttgatggactgaaaggtgacaaaggaaacccaggctggccgggggcgcctggtgcccca
gggcccaagggagacccagggttccagggcatgcctgggattggtggctctccaggaatc
acaggttctaagggtgacatgggccctccgggcgttccgggatttcaaggtcagaaaggt
ctccctggccttcaaggagttaaaggagaccaaggagaccaaggtttccctggaacgaaa
ggtcttccgggcccccccggccccccagggccttacgacatcatcaaaggggagccaggg
ctccctggtccagagggtcccgcaggtctgaaggggcttcagggacctccaggccccaag
ggacagcaaggtgtgacggggttggtgggcttacctggaccaccaggtatccccgggttt
gacggtgcccctggccagaagggagagacaggaccctttggacctcctggtccgagaggg
tttccgggcccgccaggccctgatggactgccaggatccatggggcccccgggcaccccg
tctgttgatcacggcttccttgtgaccaggcacagtcaaacaatagatgatccacagtgt
cctcctgggaccaaaatcctttaccacgggtactctctgctctacgtgcaaggcaacgag
cgggcccacgggcaggacttgggcacggctggaagctgcctgcgcaagttcagcaccatg
cccttcctcttctgcaacatcaacaacgtctgcaacttcgcctcccggaacgattactcc
tactggctgtccacccctgagcccatgcccatgtccatggcgcccatcactggggacaat
attaggccatttattagcaggtgtgcagtgtgtgaggcgccagccatggtgatggccgtg
cacagccagaccattcagatcccgcagtgccccagcggctggtcctcgctctggattggc
tattcctttgtgatgcacactagcgctggtgccgaaggttctggtcaagccctggcgtcc
cccggctcctgtctggaagagtttagaagtgcgcccttcatcgagtgccacggccgtggg
acttgtaattactatgcaaacgcttacagcttttggcttgctactatcgagaggagcgag
atgttcaagaagcccacgccatccaccttgaaggctggggagctgcgcacgcacgtcagt
cgctgccaagtctgtatgagaagaacataa

KEGG   Equus caballus (horse): 100066264
Entry
100066264         CDS       T01058                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04974  Protein digestion and absorption
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100066264 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100066264 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100066264 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100066264 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    100066264 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100066264 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100066264 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100066264 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100066264 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100066264 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100066264 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100066264 (COL4A2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100066264 (COL4A2)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100066264 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 100066264
NCBI-ProteinID: XP_023477593
Ensembl: ENSECAG00000021314
VGNC: 16739
LinkDB
Position
17
AA seq 1712 aa
MDRHQCAASSPALRRWLLLGFVTVGLLAHSVLGGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGPPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGPPGYDGCNGTRGDAGPQGPSGSGGFPGSPGPQGPKGQKGEPYALSSEDRD
KYRGEPGEPGLVGFQGPPGRPGPVGPMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGKKG
EKGDMGQPGPNGLPSDTHHAIIGPTKEVFHPDQYKGEKGSEGEPGRQGISLKGEEGIMGF
SGARGAPGFDGEKGSPGQKGSRGLDGYQGPDGRPGPKGEVGDRGLPGPPAYSPHPSLGKG
ARGDPGFPGAHGEPGTRGEPGDPGPPGLPGTSIGDEDEKRGLPGEMGPKGFIGEPGLPAL
YPGPPGADGKPGLQGPPGPAGPPGPDGFLFGLKGTGGTAGYPGPSGFPGARGQKGWKGDA
GDCRCVEGDEFVTGLPGLPGPKGFPGINGEPGRKGGQGDPGQHGIPGFPGFKGAPGDIGP
PGPKGVKGDSRTVTTKGERGQPGVPGVPGMKGDDGIRGRDGLDGFPGLPGPPGDGIKGPP
GDTGHPGAPGTKGIPGERGPPGLGLPGPKGEHGFPGDAGFPGPPGLPGPPGPPGSPGLLD
CDAGVKRPIGGDGQETVQPGCVGGPKGSAGQPGPPGPTGAKGLRGIPGFSGADGPPGLKG
LPGDPGREGYPGPPGFVGPRGSKGAVGLPGPDGQPGLTGLPGPVGPPGDRGLPGEALGAY
PGPQGDAGLPGQPGLKGPPGERGPPGFRGSQGMPGMPGLKGQPGFPGPSGQAGLPGPPGQ
HGFPGAPGQQGPLGLPGAPGFGGLPGDRGDPGDTGVPGPVGMKGVPGDRGDPGLLGDRGH
PGSPGFKGVAGMPGIPGPKGGRGSPGMDGFQGLLGLKGRPGLPGSKGEAGFFGVPGLKGL
AGEPGVKGSRGDPGPPGPPPIILPGMKDIKGEKGDEGPMGLKGYLGLKGVPGMPGIPGLS
GIPGLPGRPGHIKGVKGDIGVPGVPGVPGFPGVPGPPGIIGFPGFTGSRGDKGAPGRAGL
YGESGPTGDFGDIGDTIDLPGSPGLKGERGLTGTPGLKGFFGEKGTEGEVGFPGITGAVG
VQGPPGLKGQTGFPGLTGLHGPQGEPGRVGRPGDKGDSGWPGVPGLPGFPGIRGISGLHG
LPGTKGSPGSPGADIHGDPGFPGPAGDRGDPGEANTLPGPAGAPGQKGERGAPGERGPVG
SPGLRGFPGITPPSNISGSPGDKGAPGIFGLEGYRGPPGPPGPAALPGSKGEEGNPGVTG
NPGTKGWGGDPGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGSVGDRGPKGPKGDRGLPG
TPGAVGSPGIAGIPQKIAIQRGPVGPQGRRGPPGAQGEMGPQGPPGEPGLRGAPGKAGPQ
GRGGVSAVPGFRGDQGPMGHQGPIGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEEDIRPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGAPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5139 nt   +upstreamnt  +downstreamnt
atggacagacaccagtgcgcggcgtccagccctgccctgcggcggtggctgttgctgggg
ttcgtgacagtggggctcctggcccacagcgtccttgggggtgtgaagaagtttgatgtg
ccctgtggagggagagactgcagtgggggctgccagtgctaccccgagaaaggaggacgg
ggtcaaccagggccagtgggcccccaggggtacaacgggcccccagggttacaaggattc
ccaggactgcagggccgcaaaggtgacaagggggaaagaggccctcccgggatcacagga
ccaaaaggagatgtgggagcaagaggcgtttctggattccctggtgccgacgggattccc
ggacatcctgggcaagggggacccagaggaccgcctggctatgatggctgcaacggaacg
aggggagacgccggcccgcagggaccctccggttctgggggcttccctggctctcctgga
ccccaaggacccaaagggcaaaaaggtgaaccttacgcactgtctagcgaggaccgagac
aaatacaggggtgaacctggggagcctggattggtcggcttccaggggcctcccggccgc
cccgggcctgtgggaccgatggggcctgttggagctccggggagaccaggaccgcctgga
ccccctggaccaaaaggacagcaaggcaacagaggacttggtttttatggaaaaaagggt
gagaagggcgacatgggccagccaggacccaatgggcttccatcagacacccaccatgcc
atcatcgggcccacgaaggaagtgttccacccagatcagtataagggtgaaaaaggaagt
gagggggaaccaggaagacaaggcatttccttgaagggagaagaaggcatcatgggcttc
tctggagcgcggggtgcccctggcttcgatggtgaaaaaggctcaccaggacaaaaagga
agcagaggactggatggttatcaaggccctgatggacgcccgggacccaagggagaagtg
ggtgaccgaggcctgccgggaccgcctgcctactcccctcatccttccctggggaaaggt
gccagaggtgacccaggattcccaggagcccatggggagccaggaacccggggtgagcca
ggagaccctggcccgccaggcctccctggcacgtccatcggagatgaagatgagaagaga
ggcttaccaggcgaaatgggacccaaaggcttcataggagagccaggcctccctgcgctc
taccccggccccccgggagctgacggaaagccagggctccaaggacccccagggcccgcc
ggaccacctggacccgatggtttccttttcggccttaaaggaacaggagggacagcgggc
taccccgggccttctggtttccctggggctcgtggacagaaaggatggaaaggtgacgcc
ggcgactgcagatgtgtagagggtgatgagttcgtcacgggtctgccggggctaccaggg
cccaagggctttccaggcatcaatggggagccgggcaggaaagggggccaaggagatcct
ggccagcacggcatccctgggttccccgggttcaagggagcccctggtgacattggacct
cctgggcccaaaggagtgaagggagattccagaacagtaaccaccaaaggtgagagggga
cagccaggtgtcccaggggtgcctggaatgaaaggtgacgacggcatccgggggcgtgac
gggctcgatggattcccaggccttccggggccccctggtgatggcatcaaaggaccccca
ggggacacaggtcacccaggagcacccggcacaaagggcattccaggagaaaggggtcct
ccaggattgggcctgccaggccccaaaggcgagcatggtttccccggagatgctggattc
cctggaccaccaggcctccccgggcctcctggccccccaggctctccaggactcctagat
tgtgatgcaggcgtgaaaagacccatcggaggtgacggacaggagactgtccagccaggt
tgtgttggagggcccaagggatcggcaggccagccaggacccccaggccccacaggtgcc
aaaggcctcagagggataccaggattctcaggagcggatggacccccagggctcaagggt
ctcccaggagacccaggacgtgagggatacccaggacccccagggttcgtggggccccga
ggatccaaaggtgcagtgggcctccctggcccggatgggcagccaggtctcaccggcctg
ccagggccagttgggcctccaggagacaggggccttcccggagaagccctgggagcctac
cctgggccccagggagatgccggcctgcctggacagcctgggctgaaaggccctccagga
gagcgaggcccacctggattcaggggaagccaggggatgccaggaatgccaggcctgaag
ggtcagcccggcttcccaggaccctcgggccaggcaggactgcccgggccaccaggacag
cacggcttcccaggagctcctggccagcaggggcccttggggctcccgggcgccccaggc
tttggaggtctacctggagacagaggggacccaggcgacacaggtgtccctggccctgtg
ggcatgaagggtgtccctggtgacagaggtgaccccggtttgttgggcgatagaggtcac
ccaggaagccctggattcaaaggagtggccggaatgcctggcatccctgggccaaaaggg
ggcagaggttcacccgggatggacggcttccaaggcctgctggggctcaaaggacgaccc
gggctcccagggagcaaaggagaggctggattttttggagttccggggctgaagggtctg
gctggtgagccgggtgtgaaaggcagccgaggggaccctggccccccaggaccgcctccc
atcatcctgccgggaatgaaagacatcaagggagagaaaggagatgaaggacccatggga
ctgaaaggatacctgggcctaaaaggtgttccaggaatgcccgggatccctggcctgtcg
ggcatccccgggctgcccgggaggcccggccacatcaaaggagtcaaaggagacatcgga
gtgcccggtgtgcctggcgtgccaggattcccgggggtgcccggtcctcccggcatcata
gggtttcccgggttcacaggaagtaggggtgacaagggagctccggggagagcaggcctg
tacggcgagagtggccccacaggcgatttcggtgacattggagacaccatagatttacca
ggaagcccgggcctgaagggggagcggggcctcactggaacaccaggtctaaagggattc
ttcggagagaaaggaacagagggcgaagtcggcttcccggggataacaggcgccgtggga
gtccaagggccccccggactgaaagggcaaacaggctttccaggactgacggggctgcac
gggcctcagggagagccaggtcgggttggaaggcctggcgacaaaggagactctggctgg
ccaggggttcccggcttaccaggttttccgggcatccgaggcatcagcggattacacggc
ctgccaggcaccaaaggctcccccgggtccccaggtgcagacatccacggagacccaggt
ttcccaggtcctgctggggacagaggtgacccaggagaggccaacacccttccaggccct
gcgggagccccaggacagaagggggagcgaggagccccaggggagcgaggcccagtcggg
agtccaggacttcggggtttcccaggcatcacccccccttccaacatctctgggtcacct
ggtgacaaaggggcgccggggatattcggcctggaaggttatcgaggtcccccagggcca
cctgggcctgctgctcttcccggaagcaaaggagaggaggggaacccaggagttacagga
aacccagggaccaaaggatggggcggagaccctgggccccaaggccggcctggcgtgttt
ggtctcccaggagaaaaagggcccagaggtgagcaaggattcatggggaacacaggaccc
accgggagcgtgggcgaccgaggccccaagggacccaaaggagaccgcggactcccgggt
accccaggtgctgtggggtccccggggattgcaggaatccctcagaagattgccatccag
cgggggccagtgggtccgcagggaagaagaggccccccgggggcgcagggagagatgggg
ccccagggccccccaggagaaccagggctccgtggggctccggggaaggcagggccccag
ggaagaggcggtgtgtctgccgttcctggattccgaggagaccaggggcccatggggcac
cagggaccaattggccaggaaggggagccaggccgcccggggagcccaggcctgcccggc
atgcccggccgcagcgtcagcattggctacctgctggtgaagcacagtcagacggatcag
gagcccatgtgccccgtgggcatgaacaagctgtggagtgggtacagcctgctgtacttt
gaaggccaggaaaaggcccacaaccaggacctgggactagcgggctcctgcctggcccgg
ttcagcaccatgcccttcctctactgcaaccccggcgacgtctgctactacgccagccgc
aacgacaagtcctactggctctccaccaccgccccgctgcccatgatgcccgtggccgag
gaggacatcaggccctacatcagccgctgctctgtgtgtgaggccccggccgttgccata
gcggtccacagccaagacgtctccattccccactgcccagccggatggcggagtttgtgg
atcggatattccttcctcatgcacacggccgcgggcgacgagggtggcggccagtcgctg
gtgtcaccgggcagctgtctggaggacttccgcgccacgcccttcatcgagtgcaacggg
ggccgtgggacctgccactactacgccaacaagtacagcttctggctcaccaccatcccc
gagcagagcttccagggcgcgccctccgccgacacactcaaggcgggcctcatccgcaca
cacatcagccgctgccaggtgtgcatgaagaacctgtga

KEGG   Equus caballus (horse): 100066875
Entry
100066875         CDS       T01058                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha-4 isoform X2
  KO
K06241  laminin, alpha 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05143  African trypanosomiasis
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100066875 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100066875 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100066875 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100066875 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100066875 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100066875 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100066875 (LAMA4)
   05145 Toxoplasmosis
    100066875 (LAMA4)
   05143 African trypanosomiasis
    100066875 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_EGF Laminin_G_3 CheZ BAR_3_WASP_bdg
Other DBs
NCBI-GeneID: 100066875
NCBI-ProteinID: XP_001916312
Ensembl: ENSECAG00000018584
VGNC: 51046
LinkDB
Position
10
AA seq 1817 aa
MALSSAWRSVLPLWLLWGAAWSGAASGDDAALAFDIEGSSAVGRPDPPETSEPRVAPGRL
PPAAAEKCDAGYFRAQSGECLPCDCNGNANECLDGSGLCVHCQRNTTGEHCEKCLDGYIG
DSIRGAPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLL
IGSTCKKCDCNGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCA
VCSCGGGPCDSVTGECLEGFEAPTGCDKCIWDLTDDLRLAALSIEESKSGLLSVSSGAAA
HRHVNEINSTIYLLKTKLSERENQYVLRKIQINNAENTMKSLLSDVEELAGRGSQASRKS
EQAQKESMDTINHATQLVEQAHDMRDKIQEINSKMLYYGEEQELSSEEISEKLVLAQKML
EEIRRRQPFFTQRELVDEEADEAHELLSQAESWQRLYNDTRSLFPVVLEQLDDYNAKLSD
LRESLDQALDRVRDAEDMNRATAARQRDHEKQHERVREQMEGVNASLRTSLDSLTTPRLT
LSEFDDIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEAVDHARNLQQEADELSRN
LHSSDTNGLVQKALEASNVYENIANYVSEANETAELALNITDRIYDAVSGIDTQIIYHKD
ESENLLHQARELRARADSSNEEAVADTSRRVGGALARKSALKSRLNDAIKRLQATERGDA
QQRLNQSKLITEEANKTTMEVQRATAPMAGNLTHWSQNLQNFDSSAYNTAVDSARDAVRN
LTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDGQSAVEVH
PKTSMDDLKTFTSLSLYMKPPPVKQPELAGTADQFILYLGSKNAKKEYMGLAIKNDNLVY
VYNLGTKDVEIPLDSKPVSSWPAHFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEF
AGDDSLLDLDPEDTVFYVGGVPSNFKLPASLNLPGFVGCLELATLNNDVISLYNFKHIYN
MDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVRTPADNG
LILLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEISIIYHND
KKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRTLRAHLPLDINFRGCMKGFQ
FQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASTQKISFFDGFEGGFNFRTL
QPNGLLFYYASGSDVFSVSLDNGTVIMDVKGIKVQSADKRYNDGLSHFIITSVSPTRYEL
IVDKSRLGSKNPTKGKAEQPQAGEKKFYFGGSPISPQYANFTGCISNAYFTRLDRDVEVE
DFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTSQNKKGGKSKDAPSWDPAGLKF
LERNAPRDSHCQLSNRPRAIEHAYQYGGTANSRQEFEHLKGDFGEKSQFSIRLKTRSSHG
MIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFIREKSSGR
LIIDGLRVLEESLPPTGAAWKIKGPIYLGGVAPGRAVKNVQINSVYSFSGCLSNLQLNGA
SIASASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLV
HGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQLD
VDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTQRLAPGRPFTGCIRHFMIDGRPVSFS
KAALVSGAVSINSCPAA
NT seq 5454 nt   +upstreamnt  +downstreamnt
atggctttgagctcagcctggcgctcagtcctgcctctgtggctcctctggggcgctgcc
tggtccggcgcggcgtccggagacgacgccgctttggcttttgacattgaagggagctca
gcggtcggcagaccagacccgcctgagacaagcgagccccgcgtggctcccggaaggctg
ccgcctgctgccgccgagaaatgtgatgctggatactttcgggcccagtcaggagaatgt
ttgccctgtgactgtaacggtaacgccaacgagtgcttggacggctctggactctgtgtg
cactgccagcggaacacaacgggagagcactgtgagaaatgtctagatggttatatcgga
gattccatcaggggagccccccggttctgccagccgtgcccctgtcccctgccccatttg
gccaattttgcagaatcctgctataggaaaaacggagcagtccggtgtatttgtaaagaa
aactacgctggacctaactgtgaaaggtgtgctcctggttactatggaaaccccttgctg
attggaagcacctgtaagaaatgtgactgcaatggaaattcagatcccaacctgatcttt
gaagattgtgatgaggttactggccagtgtaggaattgcttacgcaacacaacaggattt
aagtgtgaacgctgtgcccctggttactatggggatgccagaatagccaagaactgtgca
gtgtgcagttgcgggggaggtccatgtgacagtgtaaccggagaatgcttggaaggtttt
gaagcccctacaggctgtgataagtgcatctgggatctgactgatgaccttcggttagcg
gctctctccattgaagaaagcaaatcgggtctattaagtgtgtcatctggtgctgcggct
cataggcacgtgaatgaaatcaactccaccatctacctcctcaaaacaaaattgtcagaa
agagaaaaccagtacgtcctaagaaagatacaaatcaacaacgctgagaacacaatgaaa
agccttctgtctgacgtggaggaattagctggaaggggaagtcaagcctcaagaaagagt
gaacaggctcagaaagaaagcatggataccattaaccacgcaactcagcttgtagagcaa
gcccacgatatgagggataaaatccaagagatcaacagcaagatgctctattatggggag
gagcaggaacttagctctgaggagatctctgagaagctggtgttggcccagaagatgctt
gaggagattagacgccgtcaaccattcttcactcaacgggagctagtggatgaggaggca
gacgaagcccatgaactgctgagccaggctgagagttggcagcggctgtacaatgatact
cgctctctgtttcctgtcgtcctggagcagctggacgactacaatgctaagttgtcagac
ctccgggagtcactggaccaggcccttgaccgtgtcagggatgccgaagatatgaacaga
gccacagcagccaggcagcgggaccatgagaaacaacacgagagagtgagggaacagatg
gaaggagtgaacgcttctctgaggacgtctttggattctctgacaacacctcgtctgacc
ctctcagaatttgatgatataataaagaatgcatcagggatttatgccgaaatagatgga
gccaaaaatgaactacaaggaaaactatccaacttaagtaacctcagtcatgatttagtc
caggaagctgttgaccatgcacggaaccttcaacaggaggctgatgagctgagcaggaat
ttgcacagttcggatacaaatgggctggtacagaaggctttggaagcttcaaatgtctat
gaaaatattgccaattatgttagtgaagccaacgaaacagcagaattggctttgaacatc
actgaccggatttacgatgctgtgagcggcattgatacccagatcatttaccataaagat
gaaagcgagaatctcctccatcaagcaagagaactgcgagcgagggcagattctagcaac
gaagaggcagtggcggacaccagcagacgtgtgggtggagcgctagcaaggaagagtgcc
cttaaaagcaggttaaatgatgccattaagcgactacaagccacggagagaggtgacgct
cagcagcgcctgaatcagtccaagttgatcaccgaggaagctaacaagaccacaatggaa
gtccagcgggcaacggcccccatggctggcaatctaacccactggtcacagaatctgcaa
aattttgactcttctgcttacaacactgcagtggattccgctagagatgcagtaagaaat
ctgacagaggttgtccctcagctcctggatcagcttcgtacagtcgagcagaagcggcct
gcaagcaacgtttctgccagcatccagaggatccgagagctcatcgctcagaccagaagt
gtcgccagcaagatccaagtctccatgatgtttgacggccagtcagcggtggaagtgcac
cccaaaaccagtatggatgacttgaagaccttcacatctctgagcctgtacatgaaacct
cctcctgtgaagcagccagaactggctgggactgctgatcagtttatcctgtacctcgga
agcaaaaacgccaaaaaagagtacatgggtcttgcaatcaaaaatgataacctggtatac
gtttataatttgggaactaaggatgtagagattcccctggactccaagcctgtcagttcc
tggcctgctcacttcagcattgtcaagattgaaagggtaggaaaacacggaaaggtgttt
ttaacagtcccaagcctaagtagcacggcagaggaaaagtttattaaaaagggagaattt
gcgggagatgactccttgttggatctggaccccgaggacaccgtgttttatgttggcggg
gtgccttcaaacttcaagctcccggccagcttaaacctgcctggcttcgttggctgcttg
gaactggccacgttgaataacgatgtgatcagcttgtacaactttaagcacatctacaac
atggatccctccaagtcagtgccctgcgccagagataaactggccttcactcagagtcgg
gctgccagctatttcttcgatggctctagttatgctgtggtgagggacatcacaaggaga
gggaagtttggtcaggtgactcgctttgacatagaagttcgaacaccagctgacaatggc
cttatcctcctgatggtcaatggaagcatgtttttcagcctggagatgcgcaatggttac
ctgcacgtgttctatgacttcgggtttagcaatggccctgtgcatcttgaagatacattg
aagaaagctcaaattaatgatgcaaaataccatgagatatcgatcatttaccacaacgat
aagaaaatgattttggtagttgacagacgacatgtcaagagcatggataacgaaaagatg
aaaataccttttacagacatatacattggaggggctcccccagaaatcttacaatccagg
accttaagagcacaccttcccctagatatcaacttcagaggatgcatgaagggtttccag
ttccagaagaaagacttcaatttgttagagcagacagaaaccctgggagttggttatgga
tgcccagaagactctcttatatctcgtagagcgtatttcaatggacagagtttcattgct
tccactcagaaaatatctttcttcgatggctttgaaggaggtttcaatttccgaacatta
cagccaaatgggttactattctattatgcttcagggtcagacgtgttctccgtttctctg
gataacggcactgtgatcatggatgtaaagggaatcaaggtgcagtcggcagataagcgg
tacaatgacgggctgtcccactttatcatcacctctgtctcacccacaagatatgaactg
atagtagataaaagcagacttggaagtaagaaccccaccaaagggaaagcagaacagcca
caagcaggtgaaaagaagttttacttcggcggctcacccatcagtccccagtatgctaat
ttcaccggctgtataagtaatgcttactttaccaggttggacagagatgtggaggtcgaa
gatttccagcggtattctgaaaaggtccacacttctctttatgagtgtcccattgagtct
tcaccattgtttctccttcacaaaaaaggaaaaaattcctcaaagcctaaaacaagtcag
aataaaaagggcgggaaaagtaaagatgcaccttcatgggatcctgctggcctgaaattc
ctagagcggaatgctccaagagactctcattgccagctttccaacagaccgagagccata
gagcacgcctatcagtatggagggaccgccaacagccgccaagagtttgaacacttaaaa
ggagattttggtgaaaagtctcagttttccattcgtctgaaaactcgttcctcccatggg
atgattttctatgtctcagatcaagaagagaatgacttcatgactctattcttagcccac
ggccgcttggttttcatgtttaatgttggccacaagaaactgaagattagaagccaagag
aaatacaatgatggattgtggcatgatgtgatatttatcagagaaaaaagcagcggccga
ctgatcattgatggtcttcgagttctagaagaaagccttcctcctactggagctgcctgg
aaaatcaagggccctatttacttgggaggtgtggctcccggaagggctgtgaaaaatgtc
cagataaactcagtctacagcttcagtggctgtctcagcaacctgcagctaaatggggcc
tccatcgcctccgcttctcagacgtttagcgtgactccttgcttcgaaggtccaatggaa
acaggaacttacttttcaactgaaggaggatacgtggttctagatgagtctttcaatatc
gggttgaagtttgagattgcatttgaagtccgtcccagaagcagttccgggacgcttgtt
cacggccacagtgtcaatggggagtacctaaacgttcacatgaaaaacgggcaggtcata
gtgaaagtgaacaatggcatccgagacttttccacctcagtgacaccaaagcagagtctc
tgtgatggcagatggcacagaattacagttattagagattcaaatgtggttcagttggac
gtagactctgaagtgaaccatgtggttggacccctgaatcccaaaccagttgatcacagg
gagcctgtgtttgttggaggtgttccagagtctctcctgacacagcgcttggcacccggc
agacccttcacaggctgcatccgtcactttatgatcgacgggcgcccggtgagcttcagt
aaagcagccctggtcagtggtgctgtgagcatcaactcctgtccggcagcctga

KEGG   Equus caballus (horse): 100069663
Entry
100069663         CDS       T01058                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100069663 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100069663 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100069663 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100069663 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100069663 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100069663 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100069663 (LAMC3)
   05145 Toxoplasmosis
    100069663 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 100069663
NCBI-ProteinID: XP_001499447
Ensembl: ENSECAG00000000296
VGNC: 19569
LinkDB
Position
25
AA seq 1578 aa
MAAGTLLLGLALAALAGRGARAGMGACYDGAGRPQRCLPEFENAAFGRRAEASHTCGRPP
EDFCPHVGAPAAGAQCQRCDAADPERHHNASYLTDFHSHDDSTWWQSPSMAFGVQYPTSV
NITLRLGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCQKTYGRPEGQY
LRPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISL
DRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCHGHASACGPDAAGRLVCLCQHNTTG
TDCERCRPFFQDRPWARGTAEAANECLPCNCSGHSEECTFDRELFRSTGHGGRCLRCRDH
TAGPHCERCQENFYRWDRRTPCQPCDCHPAGSLRLQCDDAGTCVCKPTVTGWKCDRCLPG
FHSLSEGGCRPCTCNPAGSLGTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCS
SCFCYGHSKVCAAAAGFREHHILSDFRQGAEGWQVGSMGGPEHPARWRPGGLPLNLGDEE
ELAAPEKFLGDQRFSYGQPLTLTFRGPPGGSPLPVQLRLEGAGLALSLRHSSPSGPRDAG
QPGEVQLHFQLQETSEDVDPPLPPFHFQRLLTNLTALRIQASSRGRSPPGQMFLMEVRLT
SAQRGLSPPASWVETCSCPKGYTGQFCESCAPGYKRETPLGGPYANCVPCTCNQHGTCDP
NTGICLCGHHTEGPSCERCLPGFYGNPFTGRADDCQPCPCPGQSACTTIPESREVVCTHC
PPGQRGRRCETCDDGFFGDPLGLSGAPQPCQQCQCSGNIDPNTVGNCDPLSGHCLRCLHN
TTGAHCEHCQDGYYGSALAPRPADKCMPCSCNPGGSVSEQRPCDPVTGQCSCLPHVTGRD
CGLCSPGFYDLQPGRGCQSCKCHPLGSQEDQCHPKTGQCPCRPGVEGQACDRCQLGFFGF
SVKGCRACRCSPLGAASAQCHENSTCVCRPGFVGYKCDRCQDNFFLTASGTHCQECPSCY
SLVKEEVAKLKARLTLMEGWLQGSDCGITWGPLDILQGEAPRGDVYQGHHLVQGAREAFL
EQVTGLEGAVKAAREQLRALSRKARCAQARAGKTCIQLADLEAALESSEEEILHAATILA
SLVIPQEGLGQPTNWSHLAAEARVLARSHRATATKIKATAQRALLASNTSYVLLWSLLEG
KVALEAQQELEDRYQAVQEAQKELGAAVAEALPEAERVLAAVQQVVTDTALRPASLPVPV
ALPQAARAGDLDPRLQALEKTVASRERVVTEAARALQATARAALHKAEPLTQLHQEARAA
LTRASSSVHAATVTVVGARTLLADLEGMKLRFPLPEDQAALMRKAGLVQDRILADARKKT
KQAERMLGNAASVSSSARKKGREAELLAKDSAKLAKALLREGKQEYRRAGRLSSQTQATL
RQASRQALALGARGRELEEAEQVGAGLSKVERQIRESRLSLEKDIEALTELLDRLGSLDT
HQTPAQALNETQRALERLRLQLGPPGALQGKLRLLEQESEQQELQIQSFESNLAEIRADK
QNLEAILHSLPESCANQQ
NT seq 4737 nt   +upstreamnt  +downstreamnt
atggcggcgggcacgctgctgctgggcctggcgctggccgcgctggcggggcgcggggcg
cgcgcgggcatgggcgcgtgctacgacggcgcggggcgccctcagcgctgcctgcccgag
ttcgagaacgcggcgttcggccggcgcgccgaggcctcgcacacgtgcggccggccgccc
gaggacttctgcccgcacgtgggcgcgccggccgcgggggcgcagtgccagcgctgcgac
gccgccgaccccgagcgccaccacaacgcctcctacctcaccgacttccacagccacgac
gacagcacctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtc
aacatcaccctccgcctggggaaagcttacgagatcacctacgtgaggctgaagttccac
accagtcgccccgagagcttcgccatctacaagcgcagccgggcgggcggcccgtgggag
ccctaccagtactacagcgcctcctgccagaagacctacggccggcccgagggccagtac
ctgcggcccggcgaggacgagcgcgtggccttctgcacctcggagttcagtgacatctcc
ccgctcagtgggggcaacgtggccttctccactctggagggccggcccagcgcctacaac
tttgaggagagccccgtgctgcaggagtgggtcaccagcacggagctgctcatctccctg
gaccggctcaacacttttggggacgacatcttcaaggaccccagggtgctgcagtcctac
tactatgccgtgtctgacttctccgtgggtggcaggtgcaagtgtcatgggcacgcgagt
gcgtgcggccctgatgcggcgggccggctggtgtgcctctgccagcacaacaccacgggc
acagactgcgagcgctgccggcccttcttccaggaccgcccgtgggcccgcggcacggcc
gaggccgccaacgagtgtctgccctgcaactgcagtggccactctgaggagtgcaccttt
gaccgggagctcttccgcagcacgggccacggtgggcgctgcctccgctgccgtgaccac
acggctgggccgcactgcgagcgctgccaggagaacttctatcgctgggaccggcgaaca
ccgtgccagccctgcgactgccacccagcaggctccctgcgcctccagtgcgatgatgcg
ggcacctgcgtctgcaagcccactgtgacgggctggaagtgtgaccgatgcctgcccggg
ttccactcgctcagtgagggcggctgcagaccctgcacctgcaatcctgctggcagcctg
ggcacctgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctg
tgtgacagatgccgcccggggacattcaacctgcagccccacaacccggccggctgcagc
agctgcttctgctatggccactccaaggtgtgtgcggccgccgccgggttccgggagcac
cacatcctctccgacttccgccagggagctgaaggctggcaggttggaagcatggggggc
ccagagcatccagcacgatggaggccaggggggctccccctgaacctgggagatgaggag
gagctcgcagcgccagagaagttcctgggagaccagcggttcagctatgggcagcccctt
acgctcaccttccggggcccccctgggggctccccgctccccgtgcagctgaggctggaa
ggggcgggcctggccctgtctctgcggcattccagcccgtccggcccccgggacgccggg
cagcctggggaggtacagctgcacttccagctgcaggagacctccgaggacgtggaccct
ccgctgccccccttccacttccagcggctgctcaccaatctgaccgcccttcgcatccaa
gccagcagccgaggccgaagccctcccggccagatgttcctgatggaggtccggctcacg
tcggcccagcgggggctgtcccccccagcctcctgggtggagacctgctcgtgtcccaag
gggtacacgggccagttctgtgaatcttgtgccccaggatataagagggagacaccactg
gggggtccctatgccaactgtgttccctgcacctgtaaccagcatggcacctgtgacccc
aacacggggatctgcctgtgtggccaccacaccgagggcccgtcctgcgagcgctgcttg
ccgggtttctatggcaaccccttcacaggccgagccgacgactgccagccctgtccgtgc
ccgggacagtcggcctgcacgaccatcccagagagcagggaggtggtgtgtacccactgc
cccccgggccagagagggcggcgctgtgagacctgtgatgatggcttttttggggaccca
ctggggctctctggagccccccagccctgccagcagtgccagtgcagcgggaatatagac
cccaacaccgtgggcaactgtgaccccctgtctggccactgcctgcgttgcctgcacaac
acaacaggtgctcactgtgagcactgtcaggatggctactatgggagcgccctggcccct
cggcccgcagacaaatgcatgccctgcagctgcaacccggggggctcagtcagtgagcag
agaccctgcgacccagtgaccggccagtgctcctgcctgcctcatgtgactggacgggac
tgtggcctctgcagccctggcttctacgacctccagcctgggaggggctgccagagctgc
aaatgccacccgctgggctcccaggaggaccagtgtcaccctaagaccgggcagtgcccc
tgtcgcccgggtgtcgagggccaggcctgcgacagatgccagctgggtttctttggcttc
tctgtcaagggctgccgggcctgcaggtgctccccgttgggcgccgcctcggcccaatgc
cacgagaacagcacctgcgtgtgcaggcccggcttcgtgggctacaagtgtgaccgctgc
caggacaacttcttcctcacggccagcggcacgcactgccaggagtgcccgtcgtgttac
tctctggtgaaggaggaggttgccaagctgaaggccaggctgaccctgatggaggggtgg
ctgcaggggtctgactgtggcataacctggggaccgctggacattctgcagggagaagcc
ccacggggggacgtctaccagggccaccacctggtgcaaggggcccgggaagccttcctg
gagcaggtgacaggcctcgagggtgctgtgaaggctgccagggagcagctccgggcgctg
agcaggaaggcacgctgtgcccaggccagagccgggaagacctgcatccagctggcagac
ctagaggcagcgctggagtcttcagaagaggagattctgcatgcagccaccatcctggcg
tctctggtgatacctcaggaggggcttggccagcccaccaactggagccacctggccgca
gaagcccgtgtccttgccaggagccacagggccaccgccaccaagatcaaggccactgct
cagagggccctgctcgcctccaacaccagttatgtgcttctctggagtctgctggagggc
aaagtggccctggaggcccagcaggagctggaggacaggtaccaggcggtgcaggaggcc
cagaaggagctgggcgcggctgtggcagaggcgctgcccgaagccgagagagtactggcc
gccgtgcagcaagttgtcacagacacggccctgcggccggcctcgctgcctgtccctgtg
gcactgcctcaggcggctcgggctggggacctggacccgaggctgcaggctctggagaag
acagtcgcatcgagagagcgcgtggtcaccgaggctgcgcgggccctccaggccaccgcc
cgggctgcactgcacaaggccgagcccctcacgcagctgcaccaggaggccagagccgcc
ctgacccgggcttcctcgtccgtccacgctgccacagtgaccgttgtgggagccaggacc
ctgctggctgacctggaaggaatgaagctgcggtttcctctgcccgaggaccaggccgcg
ttgatgaggaaggcgggtctcgtccaggacaggatcctcgcggacgcgcgaaagaagacc
aagcaggcggagaggatgctgggaaacgcggcgtctgtctcctccagcgccaggaagaag
ggcagggaagccgagctgttggccaaggacagcgccaagctcgccaaggccttgctgcgg
gaggggaagcaggaataccgccgagccggccggctgtccagccagacccaggcgacgctg
cgacaggcctcccgccaggcgctggccctgggagcgcgtggacgggagctggaggaggcc
gagcaggtgggtgccgggctgagcaaggtggagcggcagatccgggaatcgcgcctctcc
ctggagaaggacatcgaggccttgacggagctgctggacaggctggggtcgctggacacc
catcaaaccccagcccaggccctgaacgagacccagcgggcactggagcgcctgaggctg
cagctgggcccacccggggccctgcaggggaaactgaggctcttggagcaggagtcggag
cagcaggagctgcagatccagagttttgagagcaacctcgccgagatccgcgccgacaag
cagaacttggaggccattctgcacagcctgcctgagagctgtgccaaccagcagtga

KEGG   Equus caballus (horse): 100073067
Entry
100073067         CDS       T01058                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2 isoform X3
  KO
K05637  laminin, alpha 1/2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
ecb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100073067 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100073067 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100073067 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100073067 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100073067 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100073067 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100073067 (LAMA2)
   05414 Dilated cardiomyopathy
    100073067 (LAMA2)
   05416 Viral myocarditis
    100073067 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100073067 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100073067 (LAMA2)
   05145 Toxoplasmosis
    100073067 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 LXG DUF948
Other DBs
NCBI-GeneID: 100073067
NCBI-ProteinID: XP_005596974
Ensembl: ENSECAG00000023844
VGNC: 19563
UniProt: F6R9F5
LinkDB
Position
10
AA seq 3122 aa
MPGAARLLLVLLLGGGLGGGRAQRPQQQRQPQAHQQRGLFPAVLNLASNAFITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPFQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIHPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
VTNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIHGKYVGGGVCINCTRNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPVG
SLNEVCVKDEKHARRGLAPGSCHCKPGFRGVSCDRCARGYFGYPDCKPCNCSGAGSTNED
PCFGPCTCKENVEGGDCSRCKSGFFNLQEDNHKGCDECFCSGVSNRCQSSYWTYGNIQDM
SGWYLTDISGHIRVAPRQGDLHPPQQISISSSEARRALPQSYYWSAPAPYLGNKLTAAGG
QLTFTISYDLEEEEEDSERVLQLMIILEGKDFRISTAQDEVYLQPSEEHIHALSLKEEFF
TIHGSSSPVSRKEFMTVLASLKRVLVQITYSLGVDAIFRLGSVALESAVPYPTDGSVAAA
VEVCQCPAGYTGSSCESCWPRHRRVNGTIFGGLCEPCQCFGHAESCDDITGECLNCKDHT
GGPYCDRCLPGFYGDPTKGTSEDCQPCACPLNTPSNNFSPTCHLDRSLGLICDKCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVGAKNCQPCGCNVNGSFSEICHTRTGQCECKPNVQGRRCDECKPKTFGVRS
GRGCVPCNCNSFGSKSFDCEENGQCWCQPGVTGKKCDHCAHGYFNFQEGGCTACDCSHLG
NNCDPKTGQCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNINTGQCK
CRPKFSGTRCTECNRGHWNFPHCTACACFLPGTDGSTCDSETRRCSCVDQTGQCTCKVNV
EGVHCDRCQPGKFGLDAKNPLGCSSCYCFRATTQCSEAKGLIRTWVTLKPEQTILPLVDE
ALQHTTTKGIAFQHPEIVADMDLVRQDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPAHARIIIRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRI
SRTVTREDFLDVLYDIHYILIKATYGNIMRQSRISEISMEVAEQGRITPETPPARLIERC
DCPPGYSGLSCETCTPGFYRLRSEPGGRTPAPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCAVGYYGIVKGLPSDCQRCACPLISSSNNFSPSCVMEGLNDYRCSACPRG
YEGQYCERCAPGYTGSPSSPGGSCQECECDPHGSLPVPCDPVTGLCTCRPGATGRKCDGC
KHWHAREGAECVFCGDECTGLLLGDLARLEQMAMSINLTGPLPAPYKILYGLENTTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADAEQTGQDAERTNTRASSLTD
FIKELAQDAEAVNEKAVKLNETLGTQDKAFERNLQALQKEIDQMMTELRRKTLDTQKEVA
EDELVAAEGLLKKVQKLFGEPRGKNEEMEKDLREKLADYKNKVDDAWDLLREATDKIREA
NRLSAANQKNMTALEEKKEAIASGKRQTENTLKEGNDILDEANRLADEINSVIDYVEDIQ
TKLPPMSEELKDKIDDLSQEMKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKIAKEAKGLAHEATKLATGPQGSLKENAKGSLQKSFGTLNE
AKRLANDVKENDDRLNGLIARLENANERNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQIKDLHQNLDGLKKNYNQLADSVAKTNAVIKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIIVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIVPSTHHAVSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENMATASSGNNFGL
DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG
CSLENVYTVSFPRPGFVELAPVPLDVGTEINLSFSTRNESGIILLGSGGTPAPPRRKRRQ
TGQAYYAIFLNRGRLEVHLSTGTRTMRKIVVRPEPSLFHDGREHSVHVERTRGIFTVQVD
EDRRHMQNLTVEQAIEVKKLFVGGAPAEFQPSPLRNIPPFEGCVWNLVINSVPMDFARSV
SFKNADIGRCAHQKPHEDEDGAVPAEIVIQPEPVPTPASPTPTPVLAHGPCAAESEPALL
IGSKQFGLSKNSHIAIAFDDTKVKNRLTIEFEVRTEAESGLLFYMARINHADFATVQLRN
GLPYFSYDLGSGDTNTMIPTKINDGQWHKIKITRIKQEGILYVDDASNRTVSPKKADILD
VVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNLQMAEAPADLEQPTSSFRVGTCFANAQK
GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFH
VDNGAGRFTAVYDAGIPGQLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNQASTSADT
NDPVFVGGFPDGLNQFGLTTNIRFRGCIRSLRLTKGTGKPLEVNFAKALELRGVQPVSCP
AN
NT seq 9369 nt   +upstreamnt  +downstreamnt
atgcccggagccgcccggctccttctggtcctgctgctcggcgggggcctcgggggcggc
cgggcgcagcggccgcagcagcagcggcagccacaggcgcatcagcagagaggtttattc
cctgctgtcctgaatcttgcttctaatgctttcatcaccacaaacgcaacatgtggagaa
aaaggacctgaaatgtattgtaaattggtggagcatgtccctgggcagcctgtgaggaat
cctcagtgtcgaatctgcaatcaaaacagcagcaatccattccagagacacccaattacg
aatgctattgatgggaagaacacgtggtggcagagtccgagtattaagaatgggatcgaa
taccattatgtgacaattacactggatttacagcaggtgttccagattgcgtatgtgatc
gtgaaggcagctaactcccctcggcctggaaactggattttggaacgctcgcttgatgat
gtggagtacaagccctggcagtatcatgctgtgaccgacacagagtgtctcaccctctac
aacatccatccccgcacgggcccgccatcatacgccaaagacgatgaggtcatctgcact
tcattttactccaagatacaccccttagagaatggagagattcacatctctttgatcaat
gggagaccaagtgctgatgatccttctcccgaactgctggaatttacctctgctcgctac
attcgcctgcgatttcagaggatccgcaccctgaatgccgacctgatgatgtttgcccac
aaagaccccagagaaattgaccccattgtcacacgaagatattactactcggtcaaggat
atttcggttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gtgacaaataaatcccgctgtgaatgtgagcataacacgtgtggtgatagctgtgatcag
tgctgtccgggcttccaccagaaaccgtggagagccggcacgttcctgacaaaaacggaa
tgtgaagcatgtaattgtcatgggaaagctgaagaatgctattatgatgaaaatgttgcc
aggagaaatctgagtttgaatatacatggaaagtatgttggagggggtgtatgcatcaat
tgtacacgaaacactgctgggatcaactgtgagacatgtgttgatggtttcttcagaccc
aaaggggtatctccaaattatcccagaccgtgccagccatgccactgtgatccagttggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtctggcacctggc
tcctgtcactgcaagcctggcttccgaggggtgagctgcgaccgctgtgcccggggctac
tttggctatccagactgcaaaccctgcaactgcagtggggcagggagcacaaacgaggac
ccttgttttggaccctgtacctgcaaggagaacgttgaaggaggagactgtagtcgctgc
aaatccggcttcttcaatttgcaagaggataatcataaaggttgtgacgagtgtttctgt
tcgggggtttcaaaccgatgtcagagctcctactggacgtatggcaatatacaagacatg
agtggctggtatctgactgacatctccggccacattcgcgtggctccccggcagggtgac
ttacatccacctcagcagatcagcatcagcagctcggaggcccgccgtgccctgccccag
agctactactggagtgccccagctccctacctgggaaataaactcacagcagctggagga
caattgacatttaccatatcatatgacctcgaagaagaggaggaagattcagaacgtgtg
ctccagcttatgattatcttagagggaaaagacttcagaatcagcacagcccaagatgag
gtgtacctgcaaccatctgaagaacatattcatgcattgtcacttaaagaagaattcttt
accatacatggctctagttcccctgtcagtagaaaagagtttatgacagtgctggcgagt
ttaaagcgagtcctcgtacaaatcacgtacagccttggggtggatgccatcttcaggttg
ggctctgttgcccttgaatccgcggtcccctatcctactgatggaagcgttgccgcggct
gtggaggtttgtcaatgtccagcagggtacactggctcctcttgtgaatcttgttggcct
aggcacagacgagttaacggcactatttttgggggcctctgtgagccatgtcagtgcttt
ggccatgcggaatcctgtgatgacatcactggagaatgcctgaactgtaaggatcacaca
ggtggcccatattgcgatagatgtcttcctggtttctatggtgatcctacgaaaggaacc
tccgaagactgtcagccctgtgcctgtccactcaataccccatccaataactttagcccg
acatgccatttagaccgaagtcttggattgatctgtgataaatgccctgttgggtacaca
ggaccacgctgtgagaggtgtgcagaaggctattttggacaaccttctgtacctggagga
tcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgac
agcttgtctggctcctgtctgatatgtaagccaggtacaacaggccggtactgtgagctc
tgtgctgatggatattttggagacgcagttggtgcaaagaattgtcagccttgtggctgt
aatgtcaacggctccttctcggagatttgccacactaggacaggccagtgcgagtgcaaa
cccaatgtgcaggggcggcggtgtgatgaatgcaagcccaaaaccttcggggtacgatca
ggaagggggtgtgtcccctgcaactgcaattcctttgggtctaaatcgttcgactgtgaa
gagaatggtcaatgttggtgccagcctggagtaacaggaaagaaatgtgatcactgtgcc
catggctatttcaacttccaggaaggaggatgcacagcttgtgactgttcccatcttggt
aataattgtgacccaaagacaggtcaatgcatttgtcctcccaacaccattggagagaaa
tgttctaagtgtgcacctaacacctggggccacagcatcaccactggttgtaaggcttgt
aactgcagtacagtgggatccttggatttccagtgcaatataaacacgggccaatgcaag
tgtcgtccaaaattctctggcacaagatgtacagagtgcaatcgaggtcactggaacttc
cctcactgtactgcctgtgcctgcttcctgcctgggactgatggctcgacctgtgactca
gagaccagaagatgctcctgcgtcgatcagactgggcagtgcacttgtaaggtgaatgtc
gaaggtgtccactgtgacaggtgccagcctggcaaattcggactcgatgccaagaaccca
cttggctgcagcagctgctactgcttccgcgctactactcagtgctccgaagcaaaaggc
ctgatccgcacgtgggtgactctgaagcctgagcagaccattctgcccctggtggatgag
gcactgcagcacacaacgaccaaaggcattgcttttcaacacccggagattgttgcagac
atggatctagtgagacaagatctccatctggaacctttctattggaaacttccagaacaa
tttgaaggaaagaagctgatggcctatggtggcaaactcaagtatgcaatctattttgag
gctcgggaagagacaggtttctctacatacaatcctcaagttatcattcgaggcgggact
cctgctcatgctagaatcatcatcaggcatatggctgctcctctgattggccaattgacg
aggcatgaaattgaaatgacagagaaagaatggaaatattatggtgacgatccccgaatc
agtagaactgtgacccgtgaagacttcttggatgttctgtatgatatccattatattctt
atcaaggctacttatggaaatatcatgcgacaaagcaggatttctgaaatctcaatggag
gtagctgaacaaggacgcataacaccagagactcctcctgctcgcttgatagaaagatgt
gattgtcccccgggctattctggcttgtcctgcgagacatgcacgccaggattttatcgg
ctacgttctgagccgggcggccgcactcctgcaccaaccctgggcacctgtgttccatgt
cagtgtaatggacacagcagtctctgtgaccctgaaacctccatatgccagaattgtcaa
catcacactgctggtgacttctgtgaacggtgtgctgtcggatactatggaattgtcaag
ggattgccaagtgactgtcagcgatgtgcttgccctctgatttcttccagcaacaatttc
agcccttcttgtgtcatggaaggcctcaacgattaccgctgctcagcctgcccacggggg
tatgaaggccagtactgtgaacggtgtgcccctggttatactggcagcccaagcagccct
ggaggctcctgccaagaatgtgagtgtgacccccatggctcgctgcctgtcccctgcgac
ccggtcacggggctctgcacgtgccggcccggagccacggggcggaagtgtgacggctgc
aagcactggcatgcgcgcgagggcgcggagtgtgttttttgtggagatgaatgcacgggc
ctccttctcggtgacttggctcgcctggagcagatggccatgagcatcaaccttactggc
ccactgcctgctccatataaaatcctgtatgggcttgaaaatacgactcaggaactgaag
cacttgctgtcaccccagcgggccccagagaggctgattcagttggcagagggcaatctg
aacacactcgtgacagaaatgaatgagcttctgaccagggctaccaaagtgacagcagat
gccgagcaaactggacaggatgctgagaggaccaacacgagagcaagctctttaacagac
ttcattaaggagcttgcccaggatgccgaagctgtaaatgaaaaagctgtaaagctaaat
gaaactctaggaactcaagacaaggcctttgagagaaacttgcaagcacttcagaaagag
attgatcagatgatgacagaactgaggaggaaaactctagatacacaaaaggaagtcgct
gaagacgagctggtagctgctgaaggccttctgaagaaagtgcagaagctgtttggagaa
ccccgagggaaaaatgaagaaatggagaaagatcttcgggagaaactggcagactacaaa
aacaaagttgatgatgcttgggacctcttgagagaagccacagataaaatcagagaagct
aaccgcttatctgcagcaaaccagaaaaacatgactgctttggaggaaaagaaggaggcc
attgcaagtggcaaaagacaaactgagaacacattaaaagaaggcaatgacatacttgat
gaggccaaccgtcttgcagatgaaatcaactcagtcatagactacgttgaagacattcaa
actaaattgccacccatgtctgaggaacttaaagataaaatagatgacctctcccaagaa
atgaaggacaggaagcttgctgagaaggtgtcccaggctgagagccacgcagctcagctg
aatgactcatctgctgtccttgatggaatccttgacgaggctaaaaacatctccttcaat
gccactgcagccttcaaagcttacagcaatattaaggactatattgatgaagctgagaaa
attgccaaagaagccaaaggtctggcacatgaagctacaaaactggcaacaggtcctcag
ggttcattaaaggaaaatgccaaaggctcccttcagaaaagcttcgggactcttaatgaa
gccaagaggttagcaaatgatgtaaaagaaaatgatgaccgtctgaatggcttgatcgcc
agattggaaaatgccaatgagagaaatggggatctcctgagagctctgaacgacactttg
ggaaagttatcggccattccaaatgacacagccgctaaactgcaagccgttaaggacaaa
gccagacaagccaatgacacggcaaaggatgtgctggcacagattaaagatctccaccag
aacttggacggcctgaagaaaaattacaatcagctggcagacagcgtggccaaaacaaat
gctgtgattaaagatccttcgaagaacaaaatcattgcagatgcagatgccactgtgaaa
aatctagaacaagaggctgatcggctgatagataaactcaaacccatcaaggaacttgag
gataacctgaagaaaaacatctctgagataaaggaactgataaaccaagcccggaaacaa
gccaattctatcaaagtatctgtgtcatctggaggtgactgcattcgaacatacaagcca
gaaatcaagaaaggaagctacaacaatatcattgtcaacgtaaagacagctgttgctgac
aacctccttttttatcttggaagtgccaaatttatcgactttctggctatagaaatgcgt
aaaggaaaagtcagcttcctctgggatgttggatccggagttggacgtgtagagtatcca
gatttgactattgatgactcatattggtaccgtattgaggcatcaagaactgggagaaat
ggaactatttctgtaagagcactggatggacccaaagccagcattgtgcccagcacacac
cacgcagtgtctcctccggggtatacaattctagatgtggatgcaaatgcaatgctcttt
gttgggggcttgactgggaaattgaagaaggctgatgctgtgcgtgtcattacattcact
ggctgtatgggagaaacatactttgacagcaaacctatagggttgtggaatttccgagaa
aaagaaggcgactgcaaaggatgtaccgtcagtcctcaggtggaagatagtgagggaacg
attcagtttgatggggaaggctatgcactggtcagtcgccccattcgctggtaccccaac
atctccactgtcatgttcaagttcaggacgttttcttcaagtgctctcctgatgtacctt
gccacacgagacctgaaagatttcatgagtgtggagctcactgatgggcacataaaagtc
agctatgatctgggttcaggaatggcttctgttgtcagcaatcaaaaccataatgacggg
aagtggaaatcattcaccctgtcaagaattcaaaaacaagccaatatatccattgtagac
atagataccaaccaggaggagaacatggcaactgcatcctctggcaacaactttggtctt
gacttgaaagcagacgacaaaatatattttggtggtctgccaacactgagaaacttgagt
atgaaagcaaggccagaagtaaatttgaagaaatattctggctgcctcaaagatattgaa
atttcaagaactccgtataatatactcagtagccctgattatgttggcgtcaccaaagga
tgttcgcttgagaacgtttacacagttagcttccccaggcctggttttgtggagctggcc
cctgtgccacttgatgtcggaacagaaataaacctgtccttcagcaccaggaatgagtct
ggtatcattctcttgggcagtggagggacaccagcaccacctaggagaaagcgaagacaa
actggccaggcctattatgcaatattcctgaacaggggccgtctggaagtgcatctctcc
acagggacacgaacaatgaggaaaattgtcgtcagacccgagccgagtctgtttcatgat
gggagagaacattccgttcacgtggagagaactagaggcatctttactgttcaagtcgat
gaagacagaaggcatatgcaaaacctgacagtagaacaggcgattgaagttaaaaagctt
ttcgttgggggtgctccagctgaatttcaaccttcccctctcagaaatattcctcctttt
gaaggctgtgtgtggaaccttgttataaactctgtccccatggactttgcacggtctgta
tccttcaaaaatgcagacattggtcgctgtgcccatcagaaaccccacgaggatgaagat
ggagcagttccagctgaaatagtcatccagccagagccagttcccaccccagcctcccct
acacccactccagttctggcacatggtccttgtgccgcagaatcagaaccagctcttttg
atagggagcaagcagtttgggctttccaaaaacagtcatattgcaattgcatttgatgac
accaaggttaaaaatcgcctcacaattgagtttgaagtgcgaaccgaagctgaatcaggc
ctgcttttttacatggctcggatcaatcatgctgattttgctacagttcagctgagaaat
ggattgccctacttcagttatgacttgggaagtggtgacactaacaccatgatccccacc
aaaatcaatgatggccagtggcacaagattaagattacacgaattaagcaagaaggaatt
ctttatgtagatgatgcctccaacagaaccgtcagtcccaagaaagctgatatcctggat
gttgtgggaatgctgtatgttggcggcttgcccattaactacactactcggagaattggt
ccagtgacctacagcattgatggctgcatcagaaatctccagatggcagaggcccctgct
gatcttgaacagccaacctccagcttccgtgttgggacatgtttcgcaaatgctcagaaa
ggaacatattttgatggaacaggctttgccaaagcagttggtgggttcaaagtgggattg
gaccttcttgtagaatttgaattccgtacaactagaaccactggagttcttctgggaatc
agcagccagaagatggatggaatgggtattgaaatgattgatgaaaagctcatgtttcat
gtggacaatggcgccggtcgattcactgctgtctatgatgctggtatcccagggcagttg
tgtgatggacaatggcataaagtcacggccaacaagatcaaacaccgcattgagctgacg
gtagatgggaaccaggtggaagcccagagcccaaaccaagcatccacatcagctgataca
aatgaccctgtgtttgtgggagggttcccagacggcctcaaccagtttggcctgacaacc
aacatccggttccgaggttgcatccggtctctgaggctcaccaaaggcacaggcaagccg
ctggaggttaattttgccaaggccctggaactaaggggcgttcaacctgtatcgtgccca
gccaactaa

KEGG   Equus caballus (horse): 791238
Entry
791238            CDS       T01058                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha-3 isoform X1
  KO
K06240  laminin, alpha 3/5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    791238 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    791238 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    791238 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    791238 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    791238 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    791238 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    791238 (LAMA3)
   05145 Toxoplasmosis
    791238 (LAMA3)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_G_3 Laminin_EGF EzrA Fez1 DUF948 NPV_P10
Other DBs
NCBI-GeneID: 791238
NCBI-ProteinID: XP_023503336
Ensembl: ENSECAG00000021277
LinkDB
Position
8
AA seq 1724 aa
MPPAVRWSAGWLWIFGAALGQCLGYDSQQQRVVFLQPPGQSHLQASYSEFKPSQGCSPGY
YRDNKGLYTGRCVPCSCNGHSHRCQDGSGICINCQHNTAGNHCERCKEGHYRNAVQGSCM
VCPCPHSNSFATGCVVTGGNVKCSCKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNCNNN
GHLGSCDPVTGDCINQEPKDDGPGEECDDCDSCVMTLLNDLATMEGELRLVKSQLQGLSA
SASTLEHMRHLETQTKDLRNQLLNYRSAISNHGSKMDGLEKELSNLNHEFETLQEKVQIN
SRKVQALPNNVDRTTQRAKELDTKIKNVIRNVHILLKQQFSGTNGEGNNVLLGDFSRELA
EADRMMRELRSRNFGKQLKDAEDGKKNAQLLLNRIRSWLEKHQVENSGLVKSIRDSLNEY
EAKLTDLRAMLQEAATQAKQAAGLNRENQKTLESIKRQVKEMNSLQSDFNKYLATADASL
LQTSAVLQLMRKSQEEYEKLAASLNEAKHELRDKVKELSKSSSKTSLVVAAEKHAQSLQE
LAKQLEEIKRNTSGDELVRCAVDAATAYENILNAIKAAEDAADKATSASESAHQTVIKEN
LPRKAKTLSSNSEKLLNEAKITQKKLQQEISPALNNLQQTLKIMTVQKGLIDTNITTIRD
DLRGIQRGDIDGMINSAKSIVRNANDITNEVLDGLTPIQTDVERIKDTYGSTQSEDFNKA
LGDADNSVKKLTNKLPDLLSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAVPM
RFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPDSRENGGTNNMFVMYLGKKDASRDYIGM
AVVDGQLTCVYNLGEREAELQVDQILTESETQESVMDRVKFQRIYQFARLNYTKKATSSK
PEATQPHDMDSGNSNTLLNLDPENAVFYVGGYPPDFRLPSRLRFPPYKGCIELDDLNENV
LSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARIPTQPNAPLPIFVQTIQTTVD
RGLLFFAENQDHFISLDIEDGSLLVRYKLNSESPEEKGIRVIINDGKDHSIQIRIGKAQK
LMRISVAREDIKINGEIFDFSTYYLGGIPISIRERFNISTPAFRGCMKNLKKTTGVVRLN
DTVGVTKKCSEDWKLVRSASFSRGGQMSFTNLDFPLPSLFQASFGFQTFQPGGILLHHQT
RTSSLQVTLEDGHIELSTTDSSSPIFKSPQTYMDGLLHYVSVISDTSGLRLLIDDQPLKN
NQRLQGFSGSQQSLRLGGSHFEGCISNVFVHRSSQSPAVLDLASKSTKREVSLGGCSLNE
PPFLMLLKGSTRFNTAKTFSINQPLQDTPVASPRSKERWRDAQSCPSPPKAQASHGALRF
GDSPTSHLLFTVPQELLKSRSRFAVDVQTTSSRGLMFYTGTRNSFMALYLSKGRLVFALG
AEGKKLKLKSKEKFNDGKWHTVAFGQDGEKARLVVDGLRAREGSWPRSFTVSLRVPVYLG
SPPSEKSKSLPQSSFVGCLRNLQLDSKPLATPSVSFGVSPCSHGSLEKGIYFSQEGGHII
LANSVLLGPEFKLVFSIRPRSLTGILIHIGSQRGKHLCVYMEAGKVTASVDSEAGGILTS
VTPKRSLCDGQWHRVAVTIKKHILHLELDTENSYTAGQLPFPPASAREPLHIGGVPANLQ
TLKLPVWKSFFGCVKNVQVNHIPVPVTEAVEVQGTVSLNGCPDH
NT seq 5175 nt   +upstreamnt  +downstreamnt
atgcccccagcagtgaggtggtccgcgggatggctttggatctttggggcagccctgggg
cagtgtctgggatacgattcacagcagcaaagggtagtgtttcttcagcctcccggtcaa
agccatctgcaagcaagttattcggagtttaaacccagccagggttgtagccccggatac
tatcgagataacaaaggcttatatactggacggtgtgttccctgcagttgcaatggacat
tcacatcgatgccaggatggctcaggaatatgtattaactgccagcataacaccgctggg
aaccactgtgagcgctgcaaggagggtcactataggaacgccgtccagggatcctgcatg
gtctgcccgtgtcctcattcaaacagttttgccaccggctgtgttgtgactgggggaaac
gtgaagtgttcctgcaaacctggatacacaggaacacagtgcgaaaggtgtgcaccggga
tatttcggaaacccccagaaatttggaggaagctgccaaccatgcaactgtaacaacaat
ggccacttgggcagttgtgaccccgtgactggagactgcataaaccaagaacccaaagat
gatggccctggagaagaatgtgatgattgtgacagctgtgtgatgacactcttgaatgac
ctggccaccatggagggtgagctccgcctagtcaagtctcagctgcagggcctgagtgcc
agcgcaagcactctggagcacatgaggcacttggagacccagaccaaggacctgaggaat
cagttgctcaactaccgttctgccatttcaaatcatggatcaaaaatggatggcctggaa
aaagaactgagtaacttaaatcatgaatttgagactttgcaagaaaaggttcaaataaat
tccagaaaagtacaagcattacctaacaatgttgatcggacaacccaaagagcaaaagag
ctggacacaaagattaaaaatgtcatccggaatgtgcacattctcttgaagcagcagttc
tctgggacaaatggagaaggaaacaacgtcctgttaggtgatttttccagagagttggct
gaagctgaccgcatgatgagagaactgcggtcccgcaacttcggaaagcagctgaaagac
gcagaagatggaaaaaaaaacgctcagctcttgctgaatcggataaggagctggctggaa
aaacaccaggtagagaacagtggacttgttaagagtatacgggattctttaaatgaatac
gaagccaaactcactgacctccgtgccatgctacaagaggcagccacccaagcaaagcag
gctgctggcctcaaccgagaaaaccagaagactttggaatccatcaagagacaagttaaa
gaaatgaattccctacagagtgacttcaacaagtatctagccactgcagatgcctcctta
ctgcaaaccagtgctgtgctgcagctgatgaggaaaagccaggaggaatatgaaaaatta
gctgccagtttaaatgaagcaaaacatgaactaagggacaaagtgaaagaactttccaaa
tccagcagcaaaacctccctggtggtggctgcagaaaagcacgcgcagtctttgcaagag
ctggcaaagcagctggaggagatcaagaggaacaccagtggggatgagctggtgcgctgt
gctgtggacgctgccaccgcctacgagaacatcctcaacgccatcaaagcggctgaggat
gcagccgacaaggccaccagtgcctccgagtctgcccaccagacagtgataaaggaaaat
cttccaagaaaagctaaaaccctgagttccaacagtgaaaaattgttaaatgaagccaag
ataacgcagaagaagctacagcaagaaatcagtccagctctcaacaacctacagcaaact
ctgaaaattatgacagttcagaaagggctgatagacaccaatattactaccatccgcgat
gatcttcgtgggatacagagaggtgacatcgatggtatgatcaatagtgcaaagagcata
gtcagaaatgccaatgacatcactaatgaggttctagatgggctcacccccattcagaca
gatgtggaaagaattaaggatacctatgggagcactcagagtgaagacttcaacaaggct
ctcggggatgcagataactcagtgaagaaattaaccaacaaactacctgatcttttgagc
aagattgaaagtatcaaccaacagctgttgccactgggcaacatctctgacaacgtggac
cgcatacgagagctaattcagcaggcccgagatgctgcaaacaaggttgctgtccccatg
aggttcaatggtaaatctggcgttgaagtccggctgccaaatgacctggaagatttgaaa
ggatacacatctctttctttgtttcttcaacgacctgactcaagagaaaatgggggaact
aataatatgtttgtaatgtacctcgggaagaaagatgcctccagggactacatcggcatg
gcagttgtagatggccagctcacatgtgtctacaacctgggagagcgtgaggctgaactc
caagtggaccagatcttgactgagagtgaaactcaagaatcagttatggaccgggtgaaa
tttcagagaatttatcagtttgcaaggcttaattacaccaaaaaagccacatccagtaaa
ccagaagcaactcaaccccatgacatggatagtggaaacagcaacacacttctcaatttg
gatcctgaaaatgctgtattttatgttggaggttacccacctgattttagacttcctagt
agactgagattccctccgtacaaaggttgtattgaattagatgacctcaatgaaaatgtt
ctgagcttgtacaacttcaaaaagaccttcaatctcaacacaactgaggtggagccttgc
agaaggagaaaggaagagtcagacaaaaattattttgaaggtacaggctatgctcgaatt
ccaactcaaccaaatgctcctttaccaatctttgtacagacaattcagaccactgtggat
agaggtttgctgttctttgcagaaaaccaggatcacttcatatctctagatatagaagat
ggcagtctcctagtgcgatacaagctgaattcagaatcaccggaagaaaaaggaattaga
gtcatcataaacgacgggaaagatcactcgattcagatcagaattggaaaagcccaaaaa
cttatgaggataagcgtggctcgtgaagacattaaaattaatggtgaaatatttgatttc
agcacatattatctgggaggaattccaatttcaatcagggaaaggtttaacatttctaca
ccggctttccgaggctgcatgaaaaatctgaagaaaactactggtgtcgttaggttgaat
gatactgtgggagtaacaaaaaagtgctcagaagattggaagctcgtgcgctctgcctca
ttctccaggggaggacaaatgagtttcaccaatttggacttcccattgcccagcctcttc
caggcctcctttggatttcagacctttcaacccggtggcatattattacatcatcagaca
cggacaagtagcctgcaggtcaccctggaagatgggcacattgaactgagcaccacagat
agcagcagcccaatttttaaatccccacagacgtacatggatggtttactgcattatgta
tctgtaataagcgacacctctggactccggcttctcattgatgaccagcctctgaaaaat
aaccaaaggctacaaggcttctcaggttcccagcaatccctgcgtttgggcgggagtcat
tttgagggttgtatcagcaacgttttcgtccacaggtcatcgcagagtcccgcagtcctg
gatttggccagtaaatccacgaagagagaggtgtccctgggaggctgcagtttaaacgaa
ccaccgtttctaatgttgcttaaaggttctacaaggtttaacacagccaagactttctct
atcaaccagccattgcaggacacaccagtggcctctccgaggagcaaggagaggtggcga
gatgctcagtcttgcccatcacctcccaaggcccaggcaagtcatggagcactcaggttt
ggtgacagtcccaccagccacttgctgttcacagttccccaggagttgctgaaatccagg
tcacggtttgctgtggacgtgcagacaacatcttccagagggctcatgttttacacgggc
actaggaactcctttatggctctttatctttcaaaaggacggctggtctttgcactggga
gcagaagggaaaaaactaaagctcaaaagcaaagagaagttcaatgacgggaaatggcac
acggtggcctttgggcaagatggagaaaaggcgcgcttggttgtggatggtctgagggcc
cgggaggggagctggcccagaagtttcaccgtcagcctcagagtgccagtgtacctgggg
tcacctccctcagagaagtcaaagagcctcccccaaagcagctttgtgggctgcctgagg
aaccttcagttggattcgaaacccctggctaccccttctgtaagctttggggtgtccccc
tgctcacatggctctttggagaaaggcatttatttctcccaagaaggaggtcacatcatc
ctagctaactccgtgttgttggggccagaattcaaacttgttttcagcattcgcccaaga
agtctcactggaatcctaatacacatcggaagtcaacgtgggaagcacttatgtgtttat
atggaggcaggaaaggtcacggcctccgtggacagtgaggcaggtgggatcttgacatcg
gtcacaccaaagcgttctctgtgtgacggacagtggcacagagtggcagtcaccataaaa
aaacacatccttcacctggaactggacacagaaaatagctacacagctggacagctcccc
ttcccacctgctagcgctcgggagccactgcacattggaggtgtcccagccaatttacag
accctgaagctccctgtatggaaatcattttttggctgtgtaaagaatgttcaagtcaac
cacattcctgtccctgtcactgaagccgtggaagtccaggggactgtcagtctgaatggc
tgtcctgaccactaa

KEGG   Equus caballus (horse): 791245
Entry
791245            CDS       T01058                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2 precursor
  KO
K06246  laminin, gamma 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    791245 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    791245 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    791245 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    791245 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    791245 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    791245 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    791245 (LAMC2)
   05145 Toxoplasmosis
    791245 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B DUF3287
Other DBs
NCBI-GeneID: 791245
NCBI-ProteinID: NP_001075237
Ensembl: ENSECAG00000021903
VGNC: 19568
UniProt: Q8HZI9
LinkDB
Position
5
AA seq 1190 aa
MPALWLRCGLCLALLLPAARASSGSQVCDCNGKSRQCIFDQELHKQTGNGFRCLNCNDNT
DGIHCERCKAGFYRQRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGDRCDRCLPGF
HTLTDAGCAQDQRLLDSKCDCDPAGISGPCDSGRCVCKPAVTGERCDRCRPGYYHLDGGN
PQGCTQCFCYGHSASCHSSGDYSVHKIISAFHQDVDGWKAVQRNGSPAKLQWSQRHRDIF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLSKTLPCGITKTYTFRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCVCPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIPECADCPIGFYNDPQDPRSCKPCPCRNGFSCSVMPETEEV
VCNNCPQGVTGARCELCADGYFGDPFGERGPVRPCQPCQCNNNVDPSASGNCDRLTGRCL
KCIHNTAGVHCDQCKAGYYGDPLAPNPADKCRACNCNPVGSEPVECRSDGSCVCKPGFGG
LSCEHAALTSCPACYNQVKVQMDQFMQQLQILEALISKAQGGAVPNAELEGRMQQAEQAL
RDILREAQISQDAVRSFNLRVAKARTQENSYRDRLDDLKMTVERVRALGSQYQNQVQDTR
RLITQMRLSLEESEASLQNTNIPPSEHYVGPNGFKSLAQEATRLADSHVQSASNMEQLAK
ETQEYSKELMSLVREALQEGGGSGSLDGAVVQRLVGKLQKTKSLAQELSREATQTDMEAD
RSYQHSLHLLNSVSQIQGVNDQSLQVEAKRLRQKADSLSNRVTKHMDEFKHVQSNLGNWE
EETRQLLQNGKNGRQTSDQLLSRANLAKSRAQEALSMGNATFYEVENILKNLREFDLQVG
DKRAEAEEAMKRLSYISQKVAGASDKTKQAEAALGSAAADAQRAKNAAREALEISGKIEQ
EIGGLNLEANVTADGALAMEKGLATLKSEMREVEGELSRKEQEFDMDMDAVQMVIAEAQR
VENRAKNAGVTIQDTLNTLDGILHLIDQPGSVDEERLILLEQKLFRAKTQINSQLRPLMS
ELEERAHRQKGHLRFLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctgcgctgcggcctgtgcctggcgctgctgctgcctgcggcccgg
gcctcctccgggagccaagtgtgtgattgcaatgggaagtccaggcaatgcatctttgac
caggaacttcacaaacagacaggaaatggattccgctgcctcaactgcaatgacaacact
gatggcatccactgcgagaggtgcaaggcaggattttaccgacagagagaaagggaccgc
tgtttaccctgcaattgtaactctaaaggttctcttagcgctcgatgtgacaactctgga
cggtgcagctgtaagccaggtgtgacaggagacaggtgtgaccgatgtctgcccggcttc
cacacactcactgatgctgggtgcgcccaagaccaaaggctgctagactccaagtgtgac
tgtgacccagctggcatctcagggccctgtgactcaggccgctgtgtctgcaagccggct
gtcactggagagcgctgtgataggtgtcgaccaggttactatcacctggatgggggaaac
cctcagggctgtacccagtgtttttgctatgggcattccgccagctgccacagctctggg
gactacagtgtccataaaatcatctctgccttccatcaagatgttgatggctggaaggct
gtccaaagaaacgggtctcctgcaaagctccagtggtcacagcgccatcgggatatattt
agctcagcacgacgatcagaccctgtctattttgtagctcctgccaaatttcttgggaat
caacaggtgagctacgggcaaagcctatcttttgactaccgtgtggataggggaggcaga
cacccatctgcccatgacgtgatcctggaaggtgctggtctacggatcacagctcccttg
atgccacttagcaagacactgccttgtgggatcaccaagacttacacattcagattaaat
gaacatccaagcagtaattggagcccccagctaagttactttgagtatcggaggttactg
cggaacctcacagccctgcggatccgagctacctacggagaatacagtactgggtacatt
gacaacgtgaccttgatttcagcccgccccgtttctggagccccagcgccctgggttgaa
caatgtgtatgccctgttggctacaaggggcagttctgccaggattgtgcttccggctac
aaaagagattcagccagactgggaccttttggcacctgtattccatgtaactgccaaggg
ggaggggcctgcgatccagacacaggagactgttactcaggggatgagaaccctgacatc
cctgagtgtgctgactgccccattggtttctacaacgatccacaagacccccgcagctgc
aagccgtgcccctgtcgcaatgggttcagctgctccgtgatgcctgagacagaggaggtg
gtgtgcaataactgcccccagggtgtcactggtgcccgctgtgagctctgtgctgatggc
tattttggggaccccttcggggaacgtggcccagtgaggccttgtcagccctgtcagtgc
aacaacaacgtggaccctagtgcctccgggaactgtgaccgcctgacaggcaggtgtctg
aagtgcatccacaacacagctggggtccactgtgaccagtgcaaagcaggctactatggg
gacccgttggctcccaatccagcagacaagtgtcgagcttgcaactgcaacccagtgggc
tcggagcctgtggagtgtcgaagtgatggcagctgtgtttgcaagccaggctttggtggc
ctcagctgtgagcatgcggcactgaccagctgtccagcttgctataatcaagtgaaggtt
cagatggatcagtttatgcagcagctccagatcctggaggccctgatttcgaaggctcag
ggtggagcagtacccaacgcagagctggaaggcaggatgcagcaggctgagcaggccctt
cgggacattctgagagaagcccagatttcacaagatgctgttagatccttcaatctccgg
gtggccaaggcaaggactcaagagaatagctaccgggaccgcctggatgacctcaagatg
actgtggaaagagttcgggccctgggcagtcagtatcagaaccaagttcaggatactcgc
aggctcatcactcagatgcgcctgagcctggaggaaagtgaggcttccctgcaaaacacc
aacattcctccttcagagcactacgtggggccaaatggctttaaaagtctggctcaggag
gccacgagattggcagacagccatgttcagtcagccagtaacatggagcaactggcaaag
gaaacccaggagtattccaaagagctgatgtcactggtgcgcgaggctctgcaggaggga
ggcggaagcggcagcctggacggagccgtggtgcaaaggcttgtgggaaaattgcagaaa
actaaatctctggcccaggagttgtcgagggaggccacgcaaaccgacatggaagcagat
aggtcttatcagcatagtctccaccttctcaattccgtgtcccagattcagggagtcaat
gatcagtccttgcaggtagaagcgaagaggctcagacaaaaagctgattctctctcaaac
cgtgtgactaagcatatggatgagttcaagcacgtgcaaagcaatctgggaaactgggaa
gaagaaacccggcagctcttacagaatggaaagaatgggagacagacatcagatcagctg
ctttcccgtgccaaccttgctaaaagcagagcccaagaagcactaagtatgggcaatgcc
actttttatgaagttgagaacatcttaaagaatctcagagagtttgacctgcaggttgga
gataaaagagcagaagctgaagaggccatgaagagactctcctacatcagccagaaggtt
gcaggtgccagtgacaagacgaagcaagcagaagcagccctgggcagtgctgctgccgac
gcccagagggcaaagaatgcagccagggaggccctggagatctctggcaagatagaacag
gagataggaggtctgaacttggaagccaatgtgacagcagatggagccttggccatggag
aagggactggccactctgaaaagtgagatgagagaagtggaaggagagctgtcaaggaag
gagcaggagtttgacatggatatggacgcagtgcagatggtaattgcagaggcccaaaga
gttgaaaacagagccaagaatgctggagttacgatccaagacacactcaacacattggat
ggcatcctacacctaatagaccagcctggcagtgtggatgaagagaggctgatcttactg
gagcagaagcttttccgagccaagactcagatcaacagccagctacggcccttgatgtca
gagctggaagagagggcacatcggcagaagggccacctccgtttcctggagactagcata
gatgggattctggctgatgtgaagaacctggagaacatcagggacaacctgcccccgggc
tgctacaatacccaggctcttgagcaacagtga

DBGET integrated database retrieval system