KEGG   Equus caballus (horse): 100034204
Entry
100034204         CDS       T01058                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04061  Viral protein interaction with cytokine and cytokine receptor
ecb04151  PI3K-Akt signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04672  Intestinal immune network for IgA production
ecb04940  Type I diabetes mellitus
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05162  Measles
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05320  Autoimmune thyroid disease
ecb05321  Inflammatory bowel disease
ecb05330  Allograft rejection
ecb05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100034204 (IL2)
   04151 PI3K-Akt signaling pathway
    100034204 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100034204 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100034204 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100034204 (IL2)
   04660 T cell receptor signaling pathway
    100034204 (IL2)
   04658 Th1 and Th2 cell differentiation
    100034204 (IL2)
   04659 Th17 cell differentiation
    100034204 (IL2)
   04672 Intestinal immune network for IgA production
    100034204 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100034204 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100034204 (IL2)
   05321 Inflammatory bowel disease
    100034204 (IL2)
   05330 Allograft rejection
    100034204 (IL2)
   05332 Graft-versus-host disease
    100034204 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100034204 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100034204 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100034204 (IL2)
   05162 Measles
    100034204 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100034204 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100034204 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100034204 (IL2)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Interleukins
   100034204 (IL2)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Haparin
  Cytokines
   100034204 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 100034204
NCBI-ProteinID: NP_001078902
Ensembl: ENSECAG00000015616
VGNC: 50709
UniProt: P37997 B1AB81
LinkDB
Position
2
AA seq 149 aa
MYKMQLLACIALTLAVLANSAPTSSSKRETQQQLKQLQMDLKLLLEGVNNNKNPKLSKML
TFKINMPKKATELKHLQCLEEELKPLEEMLKNFLSKDIKELMSNINVTVLGLKGSETRFT
CEYDDETGTIVEFLNKWITFCQSIFSTMT
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttggcttgcatcgcactaactcttgcagtccttgcaaacagt
gcacctacttcaagctctaagagggaaacacagcaacaactgaagcaattacagatggat
ttaaagttgcttttggaaggagttaataataacaagaatcccaaactctccaagatgctc
acatttaaaattaacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaaatgctaaaaaactttctctcgaaagatatcaaggaa
ttaatgagcaatatcaatgtaacagttctgggactaaaggggtctgaaacaagattcaca
tgtgaatatgatgatgagacaggaacaattgtagaatttctgaacaaatggattaccttt
tgtcaaagcatcttctcaacaatgacttga

DBGET integrated database retrieval system