KEGG   Equus caballus (horse): 100034225
Entry
100034225         CDS       T01058                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04151  PI3K-Akt signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04640  Hematopoietic cell lineage
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04672  Intestinal immune network for IgA production
ecb05140  Leishmaniasis
ecb05200  Pathways in cancer
ecb05310  Asthma
ecb05320  Autoimmune thyroid disease
ecb05321  Inflammatory bowel disease
ecb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100034225 (IL4)
   04151 PI3K-Akt signaling pathway
    100034225 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100034225 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100034225 (IL4)
   04660 T cell receptor signaling pathway
    100034225 (IL4)
   04658 Th1 and Th2 cell differentiation
    100034225 (IL4)
   04659 Th17 cell differentiation
    100034225 (IL4)
   04657 IL-17 signaling pathway
    100034225 (IL4)
   04664 Fc epsilon RI signaling pathway
    100034225 (IL4)
   04672 Intestinal immune network for IgA production
    100034225 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100034225 (IL4)
  09163 Immune disease
   05310 Asthma
    100034225 (IL4)
   05320 Autoimmune thyroid disease
    100034225 (IL4)
   05321 Inflammatory bowel disease
    100034225 (IL4)
   05330 Allograft rejection
    100034225 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100034225 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100034225 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100034225 (IL4)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Interleukins
   100034225 (IL4)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Haparin
  Cytokines
   100034225 (IL4)
SSDB
Motif
Pfam: IL4 Tugs
Other DBs
NCBI-GeneID: 100034225
NCBI-ProteinID: NP_001075988
Ensembl: ENSECAG00000008299
UniProt: P42202 A7LBR9
LinkDB
Position
14
AA seq 137 aa
MGLTYQLIPALVCLLACTSNFIQGCKYDITLQEIIKTLNNLTDGKGKNSCMELTVADAFA
GPKNTDGKEICRAAKVLQQLYKRHDRSLIKECLSGLDRNLKGMANGTCCTVNEAKKSTLK
DFLERLKTIMKEKYSKC
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggtctcacctaccaactgattccagctctggtctgcttactagcatgtaccagcaac
ttcatccagggatgcaaatacgacatcaccttacaagagatcatcaaaacgctgaacaac
ctcacagatggaaagggcaagaattcgtgcatggagctgactgtagcggatgcctttgct
ggcccgaagaacacagatggaaaggaaatctgcagggctgcaaaggtgcttcaacagctc
tataaaagacatgacaggtccttgatcaaagaatgcctgagcggactggacaggaacctc
aagggcatggcaaacgggacctgctgtactgtgaatgaagccaagaagagcacattgaaa
gactttttggaaaggctaaagacgatcatgaaagagaaatactccaagtgttga

DBGET integrated database retrieval system