KEGG   Equus caballus (horse): 100034244Help
Entry
100034244         CDS       T01058                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00020  Citrate cycle (TCA cycle)
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb04714  Thermogenesis
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100034244 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100034244 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100034244 (SDHA)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    100034244 (SDHA)
   05012 Parkinson disease
    100034244 (SDHA)
   05016 Huntington disease
    100034244 (SDHA)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100034244 (SDHA)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100034244 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 100034244
NCBI-ProteinID: XP_014590440
Ensembl: ENSECAG00000000397
VGNC: 22771
LinkDB All DBs
Position
21
AA seq 663 aa AA seqDB search
MSGVCALSRLLPARRLALTRAQWPATLQTRGFHFTVDGTKRASAKVSDSISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFDTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIED
GSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEK
DHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQV
LKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCKPGDKV
PPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQ
LYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRI
DEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDRTLNEADCATVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtctgtgcgttgtcgcggctgcttcctgcccggcgtctggcgctgaccagg
gcgcagtggccagcaacgttgcagacccgtggttttcacttcactgttgatgggactaag
agggcatctgctaaagtttcagattcaatttctacacagtacccggtggtggatcatgaa
tttgatgcagtggtggtaggtgctggaggggccggcctgcgagctgcgtttggcctctct
gaggcggggtttgacacagcctgtgtgacaaagctctttcccaccaggtcacacactgtc
gcagcccagggaggaatcaatgctgctctggggaacatggaagaggacaactggaggtgg
cacttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccactac
atgacagagcaggcccccgcctcggtggttgagctggagaattacggcatgccctttagc
agaaccgaagatgggaggatctaccagcgtgcctttggtggacagagcctcaagtttggg
aaaggcgggcaggcccatcggtgctgctgcgtggcagaccgcacaggccattccctgctg
cacacgttgtatggaaggtctctacgatatgataccagctattttgtagagtattttgcc
ttggatctcctgatggaaaatggggagtgccgtggggttatcgcactatgcatagaagat
gggtccatccatcgcataagagcaaagaacactgttgtagctactggaggctatgggcgc
acctacttcagctgcacgtctgcccacaccagcacaggcgacggcacggccatgatcacc
agggcaggccttccctgccaggacttggagttcgttcagttccaccctacaggcatatat
ggtgctggctgtctgatcacggaaggatgccgcggagagggtggcatcctcatcaacagt
cagggcgaaaggttcatggagcggtacgcccccgtcgcaaaggacctggcatccagagat
gttgtgtctcggtccatgactctggaaatccgggagggcagaggctgtggccctgagaag
gatcatgtctacctgcagttgcaccaccttcccccccagcagctggccacacgcctacca
ggcatttcagagacggccatgatcttcgcgggtgtggatgtcaccaaggagcccatccct
gtccttcccaccgtgcattataacatgggtggcattcccaccaactacaaggggcaggtt
ctgaagcatgtgaacggccaggatcaggtcgtgcctggcctgtacgcttgtggggaggcc
gcctgtgcctcagtgcatggcgccaaccgtcttggggcaaactcgctcttggacctggtt
gtctttggccgggcgtgtgccctgagtattgcagagtcctgcaaacctggagataaagtt
ccccctattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaactgaggttt
gctgatggcagtataagaacgtcggaactgcgactcagcatgcagaagtcgatgcaaagt
catgctgcagtgttccgtgtgggaagcgtgttacaggaaggctgtgagaaaattagccag
ctctacggagaccttaagcatctgaagacgtttgacagaggaatggtctggaatactgac
ctggtggagaccctggagctgcagaacctgatgctttgcgcgcttcagacgatttatgga
gcagaggcccggaaggagtcacgtggtgctcacgccagggaagattacaaggtgcggatt
gatgagtatgattactccaagcccatccaggggcagcagaagaagccatttgaggagcac
tggaggaagcatactctttcctatgtcgatgtcaagaccgggaaggtctcgctggaatac
agacccgtaatcgacaggactttaaacgaggctgactgcgccacagtgcccccggccatt
cgctcctactga

DBGET integrated database retrieval system