KEGG   Equus caballus (horse): 100049848
Entry
100049848         CDS       T01058                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb05144  Malaria
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05218  Melanoma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049848 (HGF)
   04014 Ras signaling pathway
    100049848 (HGF)
   04015 Rap1 signaling pathway
    100049848 (HGF)
   04020 Calcium signaling pathway
    100049848 (HGF)
   04151 PI3K-Akt signaling pathway
    100049848 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100049848 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100049848 (HGF)
   05205 Proteoglycans in cancer
    100049848 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100049848 (HGF)
   05226 Gastric cancer
    100049848 (HGF)
   05218 Melanoma
    100049848 (HGF)
   05211 Renal cell carcinoma
    100049848 (HGF)
   05223 Non-small cell lung cancer
    100049848 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    100049848 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100049848 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100049848 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100049848 (HGF)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100049848 (HGF)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100049848 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 100049848
NCBI-ProteinID: XP_014594625
Ensembl: ENSECAG00000011223
VGNC: 18769
LinkDB
Position
4
AA seq 745 aa
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNSADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVRKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKVCAHSTMNDTDIPM
ETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTADPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRQNEHLVMFRVCCFCRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGHPLIPWDYCP
ISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIK
ESWILTARQCFPARNKDLKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLK
LTRPAVLDDFVSTIDLPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCS
QYHQGKVTLNESEICAGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRP
GIFVRVAYYAKWIHKIILTYKVPQL
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagtcctgctgctgcagcatgtccttctgcatctcctt
ctgcttcccatcgccataccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaag
acaaaaaaaatgaacagtgcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaagcaagaaaacgatgcctctggttccct
ttcaatagtatgtcaagtggagtgagaaaagagtttggccatgaattcgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctacaagggaacggtg
tctatcactaagagtggcatcaaatgccagccctggaattccatgataccacatgagcac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaaccct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcgt
ggtcccatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgccagaaagatatcctgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtactgtgcaattaaagtgtgcgctcacagtactatgaatgacacagatatccctatg
gaaacaactgaatgcattcaaggtcaaggagaaggttaccggggcaccatcaataccatt
tggaatggaattccatgtcagcgttgggattcccagtatcctcatcagcatgatataact
cctgaaaatttcaaatgcaaggatctaagagaaaattattgccgaaatccagatggggct
gagtcaccctggtgttttaccgctgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgacgtgtcaagtggacaagactgttatcgtgggaatggcaaaaattacatg
ggcaatttatccaaaacacgatcgggactaacatgttcaatgtgggacaagaacatggag
gacttacacagacaaaatgagcatcttgtgatgttcagagtttgttgcttctgcaggcac
atcttctgggaaccagacgctagtaagctgaataagaattactgccggaatcctgatgat
gatgctcatggtccctggtgttacacagggcatcctctcattccttgggattattgccct
atttctcgttgtgaaggtgataccacacctacaatagtcaatttagaccatcctgtaata
tcttgcgccaaaacaaaacaattgcgagttgtaaatggaattccaacacgaacaaatgtg
ggatggatggttagtttgaaatacagaaataaacatatctgcggaggatcattgataaag
gaaagttggattcttactgcaagacaatgtttccctgctcgaaacaaagacttgaaagat
tatgaagcttggcttgggattcatgatgtccatggaagaggagatgagaaacgcaaacag
gttctaaatgtttcccagctggtatatgggcctgaaggatcagatctggtattactgaag
cttactaggcctgctgtcttggatgattttgttagtacaattgatttacctaattatgga
tgcacgattcctgaaaaaaccacttgcagtgtttatggctggggctacactggattgatc
aactctgatggtctgttacgagtagcacatctctatattatggggaatgagaagtgcagc
caatatcatcaagggaaggtgactttgaatgagtctgaaatatgtgctggggctgaaaat
attgtatcaggaccatgcgagggggattatggtggcccacttgtttgtgaacaacataaa
atgagaatggttcttggtgtcattgttcctggtcgtggatgtgccattccaaatcgtcct
ggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatattaacatat
aaggtaccacagttgtag

DBGET integrated database retrieval system