KEGG   Equus caballus (horse): 100049924
Entry
100049924         CDS       T01058                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04260  Cardiac muscle contraction
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04742  Taste transduction
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04927  Cortisol synthesis and secretion
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05031  Amphetamine addiction
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100049924 (CACNA1C)
   04020 Calcium signaling pathway
    100049924 (CACNA1C)
   04024 cAMP signaling pathway
    100049924 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100049924 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100049924 (CACNA1C)
   04929 GnRH secretion
    100049924 (CACNA1C)
   04912 GnRH signaling pathway
    100049924 (CACNA1C)
   04921 Oxytocin signaling pathway
    100049924 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100049924 (CACNA1C)
   04924 Renin secretion
    100049924 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100049924 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100049924 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100049924 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100049924 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100049924 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100049924 (CACNA1C)
   04727 GABAergic synapse
    100049924 (CACNA1C)
   04725 Cholinergic synapse
    100049924 (CACNA1C)
   04728 Dopaminergic synapse
    100049924 (CACNA1C)
   04726 Serotonergic synapse
    100049924 (CACNA1C)
   04720 Long-term potentiation
    100049924 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100049924 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100049924 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100049924 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100049924 (CACNA1C)
   05020 Prion disease
    100049924 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100049924 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100049924 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100049924 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100049924 (CACNA1C)
   05414 Dilated cardiomyopathy
    100049924 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100049924 (CACNA1C)
   04934 Cushing syndrome
    100049924 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ecb04040]
    100049924 (CACNA1C)
Ion channels [BR:ecb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100049924 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 100049924
NCBI-ProteinID: XP_023498640
Ensembl: ENSECAG00000019096
VGNC: 15982
LinkDB
Position
6
AA seq 2161 aa
MVNENTRMYIPEENHQGSNYGSPRSAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAEGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRGAPASLLDQKKGKFAW
FSHSTETHVSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRR
KCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTTEMLLKM
YSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWN
SLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQS
LLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDN
LADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEEAKEEKIELKSITADGES
PPTTKINMDDLQPNENEDKSPYSNPETAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMP
EASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFY
FDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVK
ILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL
YTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFE
GWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQ
EYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTIC
LAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSI
VDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIK
SFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATG
EAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCP
HRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKR
TSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGL
RTLHDIGPEIRRAISGDLTAEEELDKAMKEAVCAASEDDIFRRAGGLFGNHVSYYQSDGR
SAYPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTAL
GRFPRPTGYPSAVSTVEGHGLPLSPAIRVQEAAWKLSSKRCPSRESQIAMVCQEEVSHEE
TYDVKMSEDPQRGSEPSLISTERLSYQDDEHRQLTPPEEDKRDIRQSPKRGFLRSASLGR
RASFHLECLKRQKSQGGDVSQKTVLPLHLVHHQALAVAGLSPLLQRSRAPTTCPQPWATP
SSQGWPPRPIPTLRLEGAESSEKLNSSFPSIHCGSWSGEPTACGGGSSALRRARPVSLTV
PSRAGAPGRQLHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAA
DNILSGGTQQSANGTLFPFVNCRDPGQDRAGGEENETCAPALERGKSEGEPQDSRACGGS
L
NT seq 6486 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcccacgctcagctcatgccaacatgaatgccaatgcagctgcagggctcgccccc
gagcacatccccaccccgggggcagccctgtcctggcaggcagccatcgatgcggcccgg
caagccaagctgatgggcagtgctggcaatgcaaccatctccacggtcagctccacgcag
cggaagcggcagcagtatgggaaacccaagaagcaaggcagcacgaccgccacgcgcccg
ccccgcgccctgctctgcctgactctgaagaaccccatccggagggcatgcataagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagccatctatattccctttccagaagatgactccaatgccaccaactccaacctggaa
cgagtggaatatctctttctcataatttttactgtggaagcatttttaaaagtaatagcc
tatggacttctctttcaccccaacgcttacctccgcaatggttggaatttactagacttt
ataattgtggttgtagggcttttcagtgcaattttagaacaagccaccaaagccgaaggg
gccaacgctctgggcgggaagggggctggattcgacgtgaaggcgctgcgggccttccgc
gtgctgcgccccttgcggctggtgtccggagtcccaagtctccaggtggttctgaattcc
attatcaaggccatggtccccctgctgcacattgctctgctagtgctgtttgtcatcatc
atctatgctatcatcggtctggagctcttcatgggaaagatgcacaagacctgctacaac
caggagggcattgcagatgttccagcagaagatgatccttctccttgcgctttggagaca
ggccacgggcggcagtgccagaacggcactgtgtgcaagcccgggtgggacgggcccaag
catggcatcaccaactttgacaattttgccttcgccatgttgacagtgttccagtgcatc
accatggagggctggacagacgtgctgtactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgttcttagcggagagttttccaaagagagagagaaggccaaggctcggggagat
ttccaaaagctgcgagagaagcaacagctggaagaggacctcaaaggctacctggactgg
atcactcaggcagaagacatcgaccctgagaatgaggacgaaggcatggatgaggagaaa
ccccgaaacagaggcgctccagcgagcttgcttgatcagaagaaagggaagtttgcttgg
tttagtcactccacagaaacccatgtgagcatgcccacaagtgagactgagtctgtcaac
acggaaaacgtggctggaggtgacatcgagggagaaaactgcggagccaggctggcccac
cggatctccaagtctaagttcagccgctactggcgccggtggaatcggttctgcagaaga
aagtgtcgcgcagcagtcaagtctaacattttctactggctggtgattttcctggtgttc
ctcaacacactcaccatcgcctccgagcattacaaccagccccactggctcacggaagtc
caagatacggccaacaaggcactgctggccctgttcaccacggagatgctgctgaagatg
tacagcctgggcctgcaggcttactttgtgtccctcttcaaccgcttcgactgcttcatc
gtgtgcgggggcatcctggagaccatcctggtggagaccaagatcatgtctcctctgggc
atctctgtgctgagatgtgtccggctactgaggatatttaaaatcacaaggtactggaac
tccttaagcaacctggtggcatccttgctgaattctgtgcgctccatcgcctccctgctg
ctactcctcttcctcttcatcatcatcttctccctcctggggatgcagctctttggagga
aagttcaactttgatgagatgcagacccggaggagcacatttgataactttccccagtcc
cttcttaccgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatggg
atcatggcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatc
ctcttcatctgtggaaactatatcctactgaatgtgttcttggccattgctgtggacaac
ttggctgatgctgagagcctcacatctgcccaaaaggaagaggaagaagagaaggagaga
aagaagctggccaggactgccagcccagagaagaaacaagaagtggtggagaagccagca
gtagaggaggccaaggaggagaaaattgagctgaaatctattacagctgatggagagtcc
ccacccacaaccaagatcaacatggatgacctccagcccaatgaaaatgaggataagagt
ccctactccaacccagaaactgcaggagaagaagatgaggaggagcctgagatgcctgtt
ggcccccgcccccgcccactctctgagctgcaccttaaggagaaggcagtgcccatgccc
gaagccagtgcatttttcatcttcagccccaacaacagattccgcctccagtgccaccgc
atcgtcaatgacacgatcttcaccaacctgatcctcttcttcattctgctcagcagcatt
tccctggctgctgaggaccccgtccagcacacctccttcaggaaccacattctgttttat
tttgatattgtttttactaccattttcaccattgaaattgctctgaagatgactgcttat
ggggctttcctgcacaagggctctttttgccggaactacttcaacatcttggacctgctg
gtggtcagcgtatccctcatctcctttggcatccagtccagtgcaatcaacgttgtgaag
atcttgcgagttctccgagtcctcaggcctctgagggccatcaacagggccaaggggcta
aagcacgtggttcagtgtgtgttcgtagccatccggaccatcgggaacatcgtgattgtc
accacactgcttcagttcatgttcgcctgcattggggtccagctcttcaagggaaagctc
tacacctgttcagatagttccaaacagaccgaggcagaatgcaagggtaactacatcaca
tacaaggacggggaagttgaccaccccatcatccagccccgcagctgggagaacagcaag
tttgacttcgacaatgttctggcggccatgatggccctcttcacggtctccacctttgag
gggtggccagagctgctgtaccgctccatcgactcccacacggaagacaagggccccatc
tacaactaccgcgtggagatctccatctttttcatcatctacatcatcatcattgccttc
ttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcag
gaatacaagaactgtgagctggacaagaaccagcgacagtgtgtggaatacgccctcaag
gcccggcccctgcggaggtacatccccaagaaccagcaccagtacaaagtgtggtacgtg
gtcaactccacctactttgagtacctgatgttcgtcctcatcctgctcaacaccatctgc
ttggccatgcagcactacggtcagagctgcctcttcaaaatcgccatgaacatcctcaac
atgctcttcacgggcctcttcacggtggagatgatcctgaagctcattgccttcaaaccc
aagcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagcatt
gttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctctccctttatg
aacgcagaggagaactcgcgcatctccatcaccttcttccgcctcttccgggtcatgcgc
ctggtgaagctgctgagccgaggggagggcatccggacgctgctctggaccttcatcaag
tccttccaggcgctgccctacgtggcgcttctgatagtgatgctgttcttcatctacgcc
gtgatcgggatgcaggtgtttgggaagattgccctgaatgacaccacagagatcaaccgc
aacaacaacttccagactttcccccaggctgtgctgctcctcttcaggtgtgccacaggg
gaggcatggcaggacatcatgctggcctgcatgccagggaagaagtgtgccccggagtcg
gagcccagcaacagcacggaaggggaaacgccctgtggcagcagcttcgccgtcttctac
ttcatcagcttctacatgctctgtgccttcctgatcatcaacctctttgtcgctgtcatc
atggacaactttgactacctgacaagggactggtccatccttggtccccaccatctggat
gaatttaaaagaatctgggcagagtatgaccctgaagccaagggtcggatcaaacaccta
gatgtggtcacgctgctccggcggattcagcccccactgggttttgggaagctgtgccct
caccgcgtggcttgcaaacgcctggtctccatgaacatgcctctgaatagcgatgggacg
gtcatgttcaatgccaccctgtttgccctggtccggacagccctcaggatcaaaacagaa
gggaacctggaacaagccaatgaggagttgcgggccataatcaagaagatctggaagcgg
accagcatgaagctgctggaccaagtggtgccccctgcaggtgatgacgaggtcacggtt
ggcaagttttacgctactttcctgatccaagagtacttccggaagttcaagaagcgcaaa
gagcagggccttgtgggcaagccctcccagaggaacgccctgtccctgcaggccggcctg
cgtaccctgcacgacatcgggcccgagatccgacgggccatctctggagatctgacagcc
gaggaggagctggacaaggccatgaaggaggccgtgtgtgcggcctccgaggatgacatc
ttcaggagggctggtggcctgttcggtaaccacgtcagctactaccaaagcgacggccgg
agcgcctacccccagaccttcaccacccagcgcccgctgcacatcaacaaggcgggtaac
agccaaggcgacactgagtcgccatcccacgagaaactggtggactccactttcaccccc
agcagctactcgtccactggctccaacgccaacatcaacaatgccaacaacactgccctg
ggccgcttcccccgccccaccggctaccccagcgcggtcagcaccgtggagggccatggg
ctccccctgtctcctgccatccgggtgcaggaggcagcgtggaagctcagctctaagagg
tgcccctcccgggagagccagatagccatggtgtgtcaggaggaggtctctcacgaggag
acctatgacgtgaagatgagcgaagacccccagcgcggcagcgagcccagcctcatctcc
acggagaggctctcttatcaggatgatgagcatcgacagctgacaccccccgaggaggac
aagagggacatccggcaatctccaaagagaggtttcctccgctccgcctcgctaggtcgt
agggcctccttccacttggaatgtctgaagcgacagaagagtcaagggggagacgtctct
cagaagacagtcctgcccttgcatctggttcaccatcaggcattggcagtggcgggcctg
agccccctcctccagagaagccgtgcccccaccacctgcccccagccctgggccacgccc
agcagccaaggctggcccccgaggcccatccccaccctgcggctggagggggccgagtcc
agcgagaaactcaacagcagcttcccgtccatccactgcggctcctggtctggggagccc
acggcctgtggtgggggcagcagcgccctccggagagcccggcctgtgtccctcactgtg
cccagccgggccggggccccgggcaggcagctccacggcagtgccagcagtctggtggaa
gcggtcttgatttcagaaggactggggcagtttgctcaagatcccaagtttatcgaggtc
acaacccaggagctggctgacgcctgcgacatgacgatagaggagatggagaacgctgcc
gacaatatcctcagcggaggcacccagcagagcgccaacggcaccctcttcccttttgtt
aactgcagggacccagggcaggaccgagcagggggcgaggagaacgagacctgcgcgcca
gccctggagcgtgggaagagcgagggggagccccaggacagcagagcctgcggcggcagc
ctgtag

DBGET integrated database retrieval system