KEGG   Equus caballus (horse): 100050091Help
Entry
100050091         CDS       T01058                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00020  Citrate cycle (TCA cycle)
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb04714  Thermogenesis
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100050091 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100050091 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100050091 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100050091 (SDHB)
   05012 Parkinson disease
    100050091 (SDHB)
   05016 Huntington disease
    100050091 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100050091 (SDHB)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100050091 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 100050091
NCBI-ProteinID: NP_001157295
Ensembl: ENSECAG00000011758
VGNC: 22773
UniProt: F6TEX7
LinkDB All DBs
Position
2
AA seq 280 aa AA seqDB search
MAAAVGVSLRRRFPATALGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtcggagtctccttgaggcgcaggttcccggccacagcccttggcgga
gcgtgcctgcaggcctgccgaggggcccagacagctgcggccacagctccccgaatcaag
aaattcgccatctaccgatgggatccagacaagactggagataaacctcatatgcaaact
tatgaaattgatttgaataaatgtggtcctatggtattggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcatgcagagaaggcatctgcggctcc
tgtgcaatgaatatcaatggaggcaacactctagcgtgcacccggcggattgacaccaac
ctcagcaaagtctcaaaaatctaccctctcccgcatatgtatgtgatcaaggacctggtt
cctgatttgagcaacttctatgctcaatacaaatccatcgagccttatttgaagaagaag
gatgaatcccagggaggcaagcagcagtatctacagtccatagaggagcgtgagaaactg
gacgggctctacgagtgcatcctctgtgcctgctgcagcaccagctgccctagctactgg
tggaacggggacaagtatttgggccctgcggttctgatgcaggcttatcgctggatgatc
gactccagggacgacttcacagaggagcgcctggccaagctgcaggaccccttctctctc
taccgctgccacaccatcatgaactgcacgaagacctgtcccaaggggctgaatccgggg
aaagctattgctgaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagct
taa

DBGET integrated database retrieval system