KEGG   Equus caballus (horse): 100050167
Entry
100050167         CDS       T01058                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04068  FoxO signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04910  Insulin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb05010  Alzheimer disease
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100050167 (IKBKB)
   04014 Ras signaling pathway
    100050167 (IKBKB)
   04064 NF-kappa B signaling pathway
    100050167 (IKBKB)
   04668 TNF signaling pathway
    100050167 (IKBKB)
   04068 FoxO signaling pathway
    100050167 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100050167 (IKBKB)
   04150 mTOR signaling pathway
    100050167 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100050167 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100050167 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100050167 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100050167 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100050167 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100050167 (IKBKB)
   04660 T cell receptor signaling pathway
    100050167 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100050167 (IKBKB)
   04659 Th17 cell differentiation
    100050167 (IKBKB)
   04657 IL-17 signaling pathway
    100050167 (IKBKB)
   04662 B cell receptor signaling pathway
    100050167 (IKBKB)
   04062 Chemokine signaling pathway
    100050167 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100050167 (IKBKB)
   04920 Adipocytokine signaling pathway
    100050167 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100050167 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100050167 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050167 (IKBKB)
   05206 MicroRNAs in cancer
    100050167 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100050167 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100050167 (IKBKB)
   05221 Acute myeloid leukemia
    100050167 (IKBKB)
   05220 Chronic myeloid leukemia
    100050167 (IKBKB)
   05215 Prostate cancer
    100050167 (IKBKB)
   05222 Small cell lung cancer
    100050167 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100050167 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100050167 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100050167 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    100050167 (IKBKB)
   04931 Insulin resistance
    100050167 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100050167 (IKBKB)
   05135 Yersinia infection
    100050167 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100050167 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100050167 (IKBKB)
   05161 Hepatitis B
    100050167 (IKBKB)
   05160 Hepatitis C
    100050167 (IKBKB)
   05171 Coronavirus disease - COVID-19
    100050167 (IKBKB)
   05164 Influenza A
    100050167 (IKBKB)
   05162 Measles
    100050167 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100050167 (IKBKB)
   05163 Human cytomegalovirus infection
    100050167 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100050167 (IKBKB)
   05169 Epstein-Barr virus infection
    100050167 (IKBKB)
   05165 Human papillomavirus infection
    100050167 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100050167 (IKBKB)
   05142 Chagas disease
    100050167 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100050167 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100050167 (IKBKB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100050167 (IKBKB)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100050167 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 GTSE1_N Glyco_hydro_65m
Other DBs
NCBI-GeneID: 100050167
NCBI-ProteinID: XP_023486437
LinkDB
Position
27
AA seq 765 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSILAQRLERWLQLMLMWHPRRRGTDPEYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFDNSKIAYETQISPRPQPESVSCILQEPKRS
LSFFQLRKVWGQVWHSIQTLKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRLTLAQLFHQENEVR
HLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMV
RLLLQAIQGFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQ
KELWNLLKIACSKVRGPVSGSPDSMNASRLSHSGQLVSQPSTTPDSLPESAKKSEELVAE
AHSLCTQLENAIQDTMKDQDQSLRSLDWSWLQTEDNEQHSLEQAS
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccgacccagacatgtggggcctgggaaatgaaagagcga
cttgggacagggggatttggaaacgtcatccgatggcacaatcaggaaacaggtgagcag
atcgccatcaagcagtgccggcaggagctcagtccccggaatcgagagcggtggtgcctg
gagatccagatcatgagaaggctgaaccaccccaatgtggtggctgcccgggatgtccct
gaggggatgcagaacttggctcccaatgacttgcccctgctggccatggagtactgccag
ggaggagacctccgcaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcgcttagataccttcacgaaaacaga
atcatccatcgggatctaaagccagagaacatcgtcctgcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgtact
tcctttgtggggaccctgcagtacctggccccagagctgctggagcagcagaagtacacc
gtgaccgtggactactggagcttcggcaccttggctttcgaatgcatcacaggcttccgg
cccttcctccccaactggcagcccgtgcagtggcattccaaagtccggcagaagagtgag
gtggacattgttgttagtgaagatctgaatggaacagtgaagttttcaagctctttaccc
taccccaacaaccttaacagcatcctggcacagcgactggagaggtggctgcagctaatg
ctaatgtggcaccccaggagaaggggcactgaccccgagtatgggcccaacggctgcttc
aaggccctggacgacatcctaaacttaaagctggttcacatcttgaacatggtcacaggc
accattcacacctatcccgtgacagaggacgagagtctgcaaagcttgaaggccagaatc
cagcaggacacaggaatccctgaggaggaccaggagctgctgcaagaggcaggtctggcc
ttgatccccgacaagcctgccactcagtgtatttcagacggcaagctaaatgagggccgc
acactggacatggatctcgtttttctttttgacaacagtaaaatcgcctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatcctgcaagagcccaagaggagc
ctgtctttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaggactgtagccggctgcagcagggccagcgagctgccatgatgaatctcctccgg
aataacagctgcctctccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggacttcttcaaaaccagcatccagattgacctggagaagtacagtgagcag
actgagtttgggatcacatcagataaactgctgctggcctggagggagatggagcaggcc
gtggagctctgtgggcggttgacattagcacagctttttcatcaggagaatgaggtgaga
catctggtggagcggatgatggcgctgcagaccgacattgtggacttgcagaggagccca
atgggccggaagcagggggggacgctggacgacctagaagagcaggcgagggagctttac
aggagactaagggaaaagccgagagaccagcggactgacggggacagtcaggaaatggta
cggctgctacttcaggcaatccaaggcttcgagaagaaagtgcgagtgatttacacgcag
ctcagtaaaactgtggtttgcaagcagaaggctctggaattgttgcccaaggtggaagag
gtggtgagtttgatgaatgaggatgagaagactgtggttcggcttcaggagaagcggcag
aaggagctctggaatctcctgaagatcgcttgtagcaaggtccgtggtcctgtcagtgga
agcccagatagcatgaatgcttctcgccttagtcactcaggtcagctggtgtcgcagcct
tccaccacccccgacagcctacctgaatcagccaagaaaagtgaagaactggtggccgaa
gcacatagtctctgcactcagctggaaaatgcaatacaagacaccatgaaagatcaggac
cagagtttgaggtctctagactggagctggttacagacggaggacaacgagcagcatagc
ctggagcaggcctcgtga

KEGG   Equus caballus (horse): 100058432
Entry
100058432         CDS       T01058                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05340  Primary immunodeficiency
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100058432 (IKBKG)
   04014 Ras signaling pathway
    100058432 (IKBKG)
   04064 NF-kappa B signaling pathway
    100058432 (IKBKG)
   04668 TNF signaling pathway
    100058432 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100058432 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100058432 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100058432 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100058432 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100058432 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100058432 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100058432 (IKBKG)
   04660 T cell receptor signaling pathway
    100058432 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100058432 (IKBKG)
   04659 Th17 cell differentiation
    100058432 (IKBKG)
   04657 IL-17 signaling pathway
    100058432 (IKBKG)
   04662 B cell receptor signaling pathway
    100058432 (IKBKG)
   04062 Chemokine signaling pathway
    100058432 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100058432 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100058432 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058432 (IKBKG)
   05203 Viral carcinogenesis
    100058432 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100058432 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100058432 (IKBKG)
   05221 Acute myeloid leukemia
    100058432 (IKBKG)
   05220 Chronic myeloid leukemia
    100058432 (IKBKG)
   05215 Prostate cancer
    100058432 (IKBKG)
   05222 Small cell lung cancer
    100058432 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100058432 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100058432 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100058432 (IKBKG)
   05135 Yersinia infection
    100058432 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100058432 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100058432 (IKBKG)
   05161 Hepatitis B
    100058432 (IKBKG)
   05160 Hepatitis C
    100058432 (IKBKG)
   05171 Coronavirus disease - COVID-19
    100058432 (IKBKG)
   05164 Influenza A
    100058432 (IKBKG)
   05162 Measles
    100058432 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100058432 (IKBKG)
   05163 Human cytomegalovirus infection
    100058432 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100058432 (IKBKG)
   05169 Epstein-Barr virus infection
    100058432 (IKBKG)
   05165 Human papillomavirus infection
    100058432 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100058432 (IKBKG)
   05142 Chagas disease
    100058432 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100058432 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100058432 (IKBKG)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100058432 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Filament
Other DBs
NCBI-GeneID: 100058432
NCBI-ProteinID: NP_001271462
Ensembl: ENSECAG00000020595
VGNC: 18986
UniProt: F6TK31
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQHFQSSQREEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALKEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHNVQVDQLRMQTQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSMVSSERNRGMQLEDLKQQLQQAEEALVAKQEAIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKECLQEQLEQLQREYSRLKASCQESARIEDMRKRH
VEVSQPPLPPTPAHHSIHSALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtacagcctagtggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccggccatgctccac
ctgccttcggagcagggaactcctgagaccttccagcgttgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
catttccagagcagccagagggaggagaaggagttcctcatgcagaaattccaggaggcc
agaaaactggtggagagactgagcctggagaagcttgacctgaggaggcagcgggaacag
gccctgaaggaggtggaacacctgaagagatgccagcagcagatggccgaggataaggcc
tcagtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg
gaggccgccactaaggagcggcaggctctggagggcagggcccgggcggccagtgagcag
gcccggcagctggagagtgagcgggaggcgctgcagcagcagcacaacgtgcaggtggac
cagctgcgcatgcagacccagagcatggaggctgccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctacaggtagcctatcaccagctcttccaagag
tatgacaaccacatcaagagcagcatggtgagcagtgagcggaaccgaggaatgcagctg
gaagatcttaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagcg
attgacaagctcaaggaagaggccgagcagcataagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggcggaaaggcaggcccgggag
aagctggctgagaaaaaggagtgtctgcaggagcagctggagcagctgcagagggagtac
agccggttgaaggccagctgtcaggagtcagccaggatcgaagatatgaggaagcggcat
gtagaggtctcccagccccccttaccccccaccccagctcaccactccattcactcggcc
ctgcccagccagaggagaagtccccccgaggagccacccgacttctgttgccccaagtgc
cagtaccaggctcctgacatggacaccctgcagatacacgtcatggagtgcatcgagtag

KEGG   Equus caballus (horse): 100070393
Entry
100070393         CDS       T01058                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04068  FoxO signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb05010  Alzheimer disease
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100070393 (CHUK)
   04014 Ras signaling pathway
    100070393 (CHUK)
   04064 NF-kappa B signaling pathway
    100070393 (CHUK)
   04668 TNF signaling pathway
    100070393 (CHUK)
   04068 FoxO signaling pathway
    100070393 (CHUK)
   04151 PI3K-Akt signaling pathway
    100070393 (CHUK)
   04150 mTOR signaling pathway
    100070393 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100070393 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100070393 (CHUK)
   04621 NOD-like receptor signaling pathway
    100070393 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    100070393 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    100070393 (CHUK)
   04625 C-type lectin receptor signaling pathway
    100070393 (CHUK)
   04660 T cell receptor signaling pathway
    100070393 (CHUK)
   04658 Th1 and Th2 cell differentiation
    100070393 (CHUK)
   04659 Th17 cell differentiation
    100070393 (CHUK)
   04657 IL-17 signaling pathway
    100070393 (CHUK)
   04662 B cell receptor signaling pathway
    100070393 (CHUK)
   04062 Chemokine signaling pathway
    100070393 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100070393 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100070393 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070393 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100070393 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100070393 (CHUK)
   05221 Acute myeloid leukemia
    100070393 (CHUK)
   05220 Chronic myeloid leukemia
    100070393 (CHUK)
   05215 Prostate cancer
    100070393 (CHUK)
   05222 Small cell lung cancer
    100070393 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100070393 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100070393 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100070393 (CHUK)
   05135 Yersinia infection
    100070393 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100070393 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    100070393 (CHUK)
   05161 Hepatitis B
    100070393 (CHUK)
   05160 Hepatitis C
    100070393 (CHUK)
   05171 Coronavirus disease - COVID-19
    100070393 (CHUK)
   05164 Influenza A
    100070393 (CHUK)
   05162 Measles
    100070393 (CHUK)
   05168 Herpes simplex virus 1 infection
    100070393 (CHUK)
   05163 Human cytomegalovirus infection
    100070393 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100070393 (CHUK)
   05169 Epstein-Barr virus infection
    100070393 (CHUK)
   05165 Human papillomavirus infection
    100070393 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100070393 (CHUK)
   05142 Chagas disease
    100070393 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100070393 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100070393 (CHUK)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100070393 (CHUK)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100070393 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 100070393
NCBI-ProteinID: XP_023496763
Ensembl: ENSECAG00000006588
VGNC: 16541
LinkDB
Position
1
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMEHWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGNLEEQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIREADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQASAWLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHL
GTIIREANEEQGSRMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgcctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtacgaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggaatactgttctgga
ggagatcttcggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctatgtacatct
tttgtgggaacattgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcgtgtgaagagatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaacactggctacagttgatgctg
aattgggatcctcagcagagaggaggacctgttgatctaactttgaagcagccaagatgt
tttgtgttaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttcttttaccacctgatgaaagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacgggaatt
tctctcgatcctcgaaaaccagcctctcagtgtgttctagatggagtgcgaggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagctcccaatt
atacagctgcgtaaagtatgggccgaagcagtgcactacgtgtctgggctaaaagaagac
tacagcaggctctttcagggacaaagagcagcaatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggaaacctggaggagcagatcatgtctttgcacactgaa
atcatggagctacaaaagagcccctatggaagacgtcagggagacctgatggaatctctg
gaacagcgtgctatcgatctttataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggagatggtcaagatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcagagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgcacacag
agttctgcccggtctcttgtaggatccagtctagaaggtgcagtaactcctcaggcatca
gcgtggctacccccgacttcagcagaacgtgaacaccctctgtcatgcgtggtaactcct
caagatggggagactttagcacaaatgatagaagaaaatttgaactgtcttggccattta
ggcactattattcgtgaagcaaatgaggaacagggcagtaggatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system