KEGG   Equus caballus (horse): 100050227
Entry
100050227         CDS       T01058                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100050227 (PIK3R1)
   04014 Ras signaling pathway
    100050227 (PIK3R1)
   04015 Rap1 signaling pathway
    100050227 (PIK3R1)
   04370 VEGF signaling pathway
    100050227 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100050227 (PIK3R1)
   04668 TNF signaling pathway
    100050227 (PIK3R1)
   04066 HIF-1 signaling pathway
    100050227 (PIK3R1)
   04068 FoxO signaling pathway
    100050227 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100050227 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100050227 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100050227 (PIK3R1)
   04024 cAMP signaling pathway
    100050227 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100050227 (PIK3R1)
   04152 AMPK signaling pathway
    100050227 (PIK3R1)
   04150 mTOR signaling pathway
    100050227 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100050227 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100050227 (PIK3R1)
   04218 Cellular senescence
    100050227 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100050227 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100050227 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100050227 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100050227 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    100050227 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100050227 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100050227 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100050227 (PIK3R1)
   04660 T cell receptor signaling pathway
    100050227 (PIK3R1)
   04662 B cell receptor signaling pathway
    100050227 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100050227 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100050227 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100050227 (PIK3R1)
   04062 Chemokine signaling pathway
    100050227 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100050227 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100050227 (PIK3R1)
   04929 GnRH secretion
    100050227 (PIK3R1)
   04915 Estrogen signaling pathway
    100050227 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100050227 (PIK3R1)
   04917 Prolactin signaling pathway
    100050227 (PIK3R1)
   04926 Relaxin signaling pathway
    100050227 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100050227 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100050227 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100050227 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100050227 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100050227 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100050227 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100050227 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100050227 (PIK3R1)
   04380 Osteoclast differentiation
    100050227 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100050227 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100050227 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050227 (PIK3R1)
   05206 MicroRNAs in cancer
    100050227 (PIK3R1)
   05205 Proteoglycans in cancer
    100050227 (PIK3R1)
   05203 Viral carcinogenesis
    100050227 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100050227 (PIK3R1)
   05231 Choline metabolism in cancer
    100050227 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100050227 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100050227 (PIK3R1)
   05212 Pancreatic cancer
    100050227 (PIK3R1)
   05225 Hepatocellular carcinoma
    100050227 (PIK3R1)
   05226 Gastric cancer
    100050227 (PIK3R1)
   05214 Glioma
    100050227 (PIK3R1)
   05221 Acute myeloid leukemia
    100050227 (PIK3R1)
   05220 Chronic myeloid leukemia
    100050227 (PIK3R1)
   05218 Melanoma
    100050227 (PIK3R1)
   05211 Renal cell carcinoma
    100050227 (PIK3R1)
   05215 Prostate cancer
    100050227 (PIK3R1)
   05213 Endometrial cancer
    100050227 (PIK3R1)
   05224 Breast cancer
    100050227 (PIK3R1)
   05222 Small cell lung cancer
    100050227 (PIK3R1)
   05223 Non-small cell lung cancer
    100050227 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100050227 (PIK3R1)
   05017 Spinocerebellar ataxia
    100050227 (PIK3R1)
   05020 Prion disease
    100050227 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100050227 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100050227 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100050227 (PIK3R1)
   04931 Insulin resistance
    100050227 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100050227 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100050227 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100050227 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100050227 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100050227 (PIK3R1)
   05161 Hepatitis B
    100050227 (PIK3R1)
   05160 Hepatitis C
    100050227 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    100050227 (PIK3R1)
   05164 Influenza A
    100050227 (PIK3R1)
   05162 Measles
    100050227 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100050227 (PIK3R1)
   05163 Human cytomegalovirus infection
    100050227 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100050227 (PIK3R1)
   05169 Epstein-Barr virus infection
    100050227 (PIK3R1)
   05165 Human papillomavirus infection
    100050227 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100050227 (PIK3R1)
   05142 Chagas disease
    100050227 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100050227 (PIK3R1)
   01524 Platinum drug resistance
    100050227 (PIK3R1)
   01522 Endocrine resistance
    100050227 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100050227 (PIK3R1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100050227 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 AAA_13 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Transcrip_act
Other DBs
NCBI-GeneID: 100050227
NCBI-ProteinID: XP_003363892
Ensembl: ENSECAG00000019837
VGNC: 21451
UniProt: A0A3Q2LU84
LinkDB
Position
21
AA seq 454 aa
MYNTVWNMEDLDLEYAKPDINCGTDLMFYIEMDPPALPPKPPKPTTVANNGMNNNMSLQD
AEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKY
GFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH
EYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNEKEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDL
IQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSS
LKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtacaacactgtttggaatatggaagacctggatttagaatatgctaagccagatata
aattgtggcactgacttgatgttttatatagaaatggatccgccagcactgcctcccaaa
ccaccaaaacccactactgtagccaacaacggtatgaataacaatatgtccttacaagat
gctgaatggtactggggagatatctcgagggaagaagtgaatgaaaaactccgagataca
gccgatgggacctttttggtacgagacgcatctactaaaatgcatggcgattacactctg
acactaaggaaaggaggaaataacaaattaatcaaaatatttcaccgagatgggaaatat
ggtttctctgacccattaaccttcaactctgtggttgaactaataaaccactaccggaat
gaatctctagctcagtataaccccaagctggatgtgaaattactttatccagtatccaaa
taccaacaggatcaggttgtcaaagaagataatattgaagctgtagggaaaaaattacat
gaatataacactcaatttcaagaaaaaagtcgagaatatgatagattatatgaagattat
actcgcacttcccaggaaatccaaatgaaaagaacagctattgaagcatttaatgaaact
ataaaaatattcgaagaacagtgccaaacccaggagcggtacagcaaagaatacatagaa
aagtttaaacgcgaaggcaacgagaaagaaatacaaagaattatgcataattatgaaaag
ttaaagtctcgaatcagtgagattgttgacagcagaagaaggctggaggaggacttgaag
aagcaggcagccgagtatcgcgagattgacaaacgcatgaacagcattaagccagacctc
attcagctgagaaagacaagagaccagtacttgatgtggttgactcaaaaaggtgttcgg
caaaagaagttgaacgagtggttgggcaatgaaaacactgaagaccaatattcgctggtg
gaagatgatgaggatttgccccaccatgatgagaagacgtggaatgtcggcagcagcaac
cgcaacaaagctgaaaacctcttgcgagggaagcgagatggcacttttcttgtccgggaa
agcagtaaacagggctgctacgcctgctccgtggtggtggacggcgaagtgaagcattgt
gtcataaacaaaacagcgactggctacggctttgcggagccctacaacttgtacagctct
ctgaaagaactggtgctacattaccaacacacgtccctcgtgcagcacaacgactccctc
aacgtcacactagcctacccggtatatgcacagcagaggcgatga

KEGG   Equus caballus (horse): 100051623
Entry
100051623         CDS       T01058                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100051623 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100051623 (PIK3CD)
   04014 Ras signaling pathway
    100051623 (PIK3CD)
   04015 Rap1 signaling pathway
    100051623 (PIK3CD)
   04370 VEGF signaling pathway
    100051623 (PIK3CD)
   04630 JAK-STAT signaling pathway
    100051623 (PIK3CD)
   04668 TNF signaling pathway
    100051623 (PIK3CD)
   04066 HIF-1 signaling pathway
    100051623 (PIK3CD)
   04068 FoxO signaling pathway
    100051623 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100051623 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100051623 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100051623 (PIK3CD)
   04024 cAMP signaling pathway
    100051623 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100051623 (PIK3CD)
   04152 AMPK signaling pathway
    100051623 (PIK3CD)
   04150 mTOR signaling pathway
    100051623 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100051623 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100051623 (PIK3CD)
   04218 Cellular senescence
    100051623 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100051623 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100051623 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100051623 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100051623 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    100051623 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100051623 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100051623 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100051623 (PIK3CD)
   04660 T cell receptor signaling pathway
    100051623 (PIK3CD)
   04662 B cell receptor signaling pathway
    100051623 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100051623 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100051623 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100051623 (PIK3CD)
   04062 Chemokine signaling pathway
    100051623 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100051623 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100051623 (PIK3CD)
   04929 GnRH secretion
    100051623 (PIK3CD)
   04915 Estrogen signaling pathway
    100051623 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100051623 (PIK3CD)
   04917 Prolactin signaling pathway
    100051623 (PIK3CD)
   04926 Relaxin signaling pathway
    100051623 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    100051623 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100051623 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100051623 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100051623 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100051623 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100051623 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051623 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    100051623 (PIK3CD)
   04380 Osteoclast differentiation
    100051623 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100051623 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100051623 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051623 (PIK3CD)
   05206 MicroRNAs in cancer
    100051623 (PIK3CD)
   05205 Proteoglycans in cancer
    100051623 (PIK3CD)
   05203 Viral carcinogenesis
    100051623 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100051623 (PIK3CD)
   05231 Choline metabolism in cancer
    100051623 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100051623 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051623 (PIK3CD)
   05212 Pancreatic cancer
    100051623 (PIK3CD)
   05225 Hepatocellular carcinoma
    100051623 (PIK3CD)
   05226 Gastric cancer
    100051623 (PIK3CD)
   05214 Glioma
    100051623 (PIK3CD)
   05221 Acute myeloid leukemia
    100051623 (PIK3CD)
   05220 Chronic myeloid leukemia
    100051623 (PIK3CD)
   05218 Melanoma
    100051623 (PIK3CD)
   05211 Renal cell carcinoma
    100051623 (PIK3CD)
   05215 Prostate cancer
    100051623 (PIK3CD)
   05213 Endometrial cancer
    100051623 (PIK3CD)
   05224 Breast cancer
    100051623 (PIK3CD)
   05222 Small cell lung cancer
    100051623 (PIK3CD)
   05223 Non-small cell lung cancer
    100051623 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100051623 (PIK3CD)
   05017 Spinocerebellar ataxia
    100051623 (PIK3CD)
   05020 Prion disease
    100051623 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100051623 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100051623 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    100051623 (PIK3CD)
   04931 Insulin resistance
    100051623 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051623 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100051623 (PIK3CD)
   05135 Yersinia infection
    100051623 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    100051623 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051623 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100051623 (PIK3CD)
   05161 Hepatitis B
    100051623 (PIK3CD)
   05160 Hepatitis C
    100051623 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    100051623 (PIK3CD)
   05164 Influenza A
    100051623 (PIK3CD)
   05162 Measles
    100051623 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100051623 (PIK3CD)
   05163 Human cytomegalovirus infection
    100051623 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051623 (PIK3CD)
   05169 Epstein-Barr virus infection
    100051623 (PIK3CD)
   05165 Human papillomavirus infection
    100051623 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100051623 (PIK3CD)
   05142 Chagas disease
    100051623 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100051623 (PIK3CD)
   01524 Platinum drug resistance
    100051623 (PIK3CD)
   01522 Endocrine resistance
    100051623 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100051623 (PIK3CD)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100051623 (PIK3CD)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100051623 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 100051623
NCBI-ProteinID: XP_005607603
Ensembl: ENSECAG00000006847
VGNC: 21448
UniProt: F7DHK6
LinkDB
Position
2
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLV
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPLAGNWGA
STLRFPSRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRLEYLYGSYPLCRFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPTPQVQKPR
TKPPPIPVKKPSSVSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRNNPNTESAAALVISLPEVAP
HPVYYPALDKILELGRPGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKATKPHTKELMHLCMR
QETYLEALSHLQSPLDPSILLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagcgtg
gctgttgacttcctgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccactcttccac
atgctcagtgaccccgaggcctatgtgttcacctgcgtcaaccagactgcggagcagcag
gagctggaggacgagcagcggcggctgtgtgacatccagcccttcctgccggttctgcgc
ctggtggcccgcgagggcgacagggtgaagaagctcatcaactcgcagatcagccttgtc
atcggcaaaggcctccatgagtttgactccttgcgtgacccagaagtgaatgactttcgc
accaagatgcgccagttctgtgaggaggccgctgcccgccggcaacagctgggctgggag
gcctggctacagtacagctttcccctgcagctggagcccttggcgggaaactggggagcc
agcaccctacggttccccagccgggcccttctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtgtccaccaaggacgtgcccctggcactgatggcctgtgcc
ctccggaagaaggccacggtgttccggcagcccctggtggagcagcccgaggactacacg
ctgcaggtgaacgggagactcgagtacctgtacggcagctaccccctctgccgcttccag
tacatctgcagctgcctgcacagcgggctgacccctcatctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgaacagagcaaccccaccccccaagtccaaaaaccgcgc
accaaaccgccccccattcccgtgaagaagccctcctctgtgtccctgtggtccctggag
cagccgttctgcgtcgagctcatccagggcagcaaagtgaacgcagatgagcggatgaag
ctggtggtgcaggctgggcttttccatggtaatgagacgctctgcaagacggtgtccagc
tcggaggtgagcgtgtgctcagagcctgtgtggaaacagcggctggagtttgacatcaac
gtctgcgatctgccgcgcatggcccgtctctgctttgcactttacgccgtgattgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagactggggaatgctgcctctac
atgtggccctccgtcccagatgagaaaggggagctgctgaaccccacgggaaccgtgcgc
aataaccccaacactgagagcgctgccgccctggtcatctccctccccgaggtggccccc
caccccgtgtactaccctgcccttgacaagatcttggagctggggcggcccggggagcat
gggcgcttcaccgaggaggagcagctgcagctgcgggagatcctggagcggcgggggtcc
ggggagctgtatgagcatgagaaggacctggtgtggaagatgcgacacgaggtccaggag
cacttccccgaggcactggcccggctgctgctggtcaccaagtggaacaagcatgaggac
gtggcccagatgctctacctgctgtgctcctggcctgagctgcctgtgctgagcgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgcttaag
tacgagtcctacctcgactgtgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccggtccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcatggaggcgtactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaacgactttgtcaaa
gtgagctcccagaaggccaccaagccccacaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtcgccgctcgaccccagcatcctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
gtcatgtacagcaacgaggaggcgggcagcgatggcagcgtgggcatcatatttaagaac
ggggatgacctccgccaggacatgctgactctgcagatgatccagctcatggacgttctg
tggaagcaggaggggttggacctgaggatgaccccctatggctgcctctccaccggggac
cgcacgggcctcatcgaggtggtgcttcactcagacaccattgccaacatccagctgaac
aagagcaacatggcagccacggccgccttcaacaaggatgccctgctcaactggctcaag
tctaagaaccctggggaggccctggaacgagctattgaggagttcaccctctcctgcgct
ggctactgtgtggccacatacgtgctgggcatcggtgatcggcacagcgacaacatcatg
atccgcgagaatgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgactttgtccat
gtgatccagcaggggaagactaataatagtgagaaattcgaaaggttccggggctactgt
gagagggcctacaccatcctgcggcgccacgggctgctcttcctgcacctcttcgccctg
atgcgggcggccggcctgcctgagctcagctgctctaaagacatccaatatctcaaggac
tctctggccttgggaaaaacggaggaggaggctctgaagcacttccgagtgaagtttaac
gaagcgctccgggagagctggaagaccaaagtgaattggctggcccacaacgtgtccaaa
gacaacaggcaatag

KEGG   Equus caballus (horse): 100051753
Entry
100051753         CDS       T01058                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100051753 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100051753 (PIK3CB)
   04014 Ras signaling pathway
    100051753 (PIK3CB)
   04015 Rap1 signaling pathway
    100051753 (PIK3CB)
   04370 VEGF signaling pathway
    100051753 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100051753 (PIK3CB)
   04668 TNF signaling pathway
    100051753 (PIK3CB)
   04066 HIF-1 signaling pathway
    100051753 (PIK3CB)
   04068 FoxO signaling pathway
    100051753 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100051753 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100051753 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100051753 (PIK3CB)
   04024 cAMP signaling pathway
    100051753 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100051753 (PIK3CB)
   04152 AMPK signaling pathway
    100051753 (PIK3CB)
   04150 mTOR signaling pathway
    100051753 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100051753 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100051753 (PIK3CB)
   04218 Cellular senescence
    100051753 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100051753 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100051753 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100051753 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100051753 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    100051753 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100051753 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100051753 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100051753 (PIK3CB)
   04660 T cell receptor signaling pathway
    100051753 (PIK3CB)
   04662 B cell receptor signaling pathway
    100051753 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100051753 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100051753 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100051753 (PIK3CB)
   04062 Chemokine signaling pathway
    100051753 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100051753 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100051753 (PIK3CB)
   04929 GnRH secretion
    100051753 (PIK3CB)
   04915 Estrogen signaling pathway
    100051753 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100051753 (PIK3CB)
   04917 Prolactin signaling pathway
    100051753 (PIK3CB)
   04926 Relaxin signaling pathway
    100051753 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100051753 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100051753 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100051753 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100051753 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100051753 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100051753 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051753 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100051753 (PIK3CB)
   04380 Osteoclast differentiation
    100051753 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100051753 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100051753 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051753 (PIK3CB)
   05206 MicroRNAs in cancer
    100051753 (PIK3CB)
   05205 Proteoglycans in cancer
    100051753 (PIK3CB)
   05203 Viral carcinogenesis
    100051753 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100051753 (PIK3CB)
   05231 Choline metabolism in cancer
    100051753 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100051753 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051753 (PIK3CB)
   05212 Pancreatic cancer
    100051753 (PIK3CB)
   05225 Hepatocellular carcinoma
    100051753 (PIK3CB)
   05226 Gastric cancer
    100051753 (PIK3CB)
   05214 Glioma
    100051753 (PIK3CB)
   05221 Acute myeloid leukemia
    100051753 (PIK3CB)
   05220 Chronic myeloid leukemia
    100051753 (PIK3CB)
   05218 Melanoma
    100051753 (PIK3CB)
   05211 Renal cell carcinoma
    100051753 (PIK3CB)
   05215 Prostate cancer
    100051753 (PIK3CB)
   05213 Endometrial cancer
    100051753 (PIK3CB)
   05224 Breast cancer
    100051753 (PIK3CB)
   05222 Small cell lung cancer
    100051753 (PIK3CB)
   05223 Non-small cell lung cancer
    100051753 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100051753 (PIK3CB)
   05017 Spinocerebellar ataxia
    100051753 (PIK3CB)
   05020 Prion disease
    100051753 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100051753 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100051753 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100051753 (PIK3CB)
   04931 Insulin resistance
    100051753 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051753 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100051753 (PIK3CB)
   05135 Yersinia infection
    100051753 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100051753 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051753 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100051753 (PIK3CB)
   05161 Hepatitis B
    100051753 (PIK3CB)
   05160 Hepatitis C
    100051753 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100051753 (PIK3CB)
   05164 Influenza A
    100051753 (PIK3CB)
   05162 Measles
    100051753 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100051753 (PIK3CB)
   05163 Human cytomegalovirus infection
    100051753 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051753 (PIK3CB)
   05169 Epstein-Barr virus infection
    100051753 (PIK3CB)
   05165 Human papillomavirus infection
    100051753 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100051753 (PIK3CB)
   05142 Chagas disease
    100051753 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100051753 (PIK3CB)
   01524 Platinum drug resistance
    100051753 (PIK3CB)
   01522 Endocrine resistance
    100051753 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100051753 (PIK3CB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100051753 (PIK3CB)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100051753 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF4381
Other DBs
NCBI-GeneID: 100051753
NCBI-ProteinID: XP_001495466
Ensembl: ENSECAG00000023941
VGNC: 21447
LinkDB
Position
16
AA seq 1070 aa
MCFNFMMPPAMADSLDIWSVDSQIVSDGSIRVDFLLPTGIYIQLDVPREAPISYIKQMLW
KQVCDYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRVKMRKFSEEKIQSLVGLSWMDWLQQTYPPEH
EPSNLENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIRGKEDE
VSPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRVISHIWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVNCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYTNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcaacttcatgatgcctcctgctatggcagacagccttgacatctggtcagtg
gattcacagatagtatctgatggctccatacgtgtggatttccttttacccactgggatt
tatatccagttggacgtacctcgggaagctcccatttcctatattaaacagatgttatgg
aagcaagtttgcgattacccaatgtttaaccttcttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtgtatgaggagcttgaagatgaaacaagaagactgtgt
gatgtccgaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgccttg
aaggatcctgaggtgaatgaattccgagtaaaaatgcgaaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctacagcagacatatccaccagagcat
gaaccctctaaccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtttgactattcgtgggaaagaagatgaa
gtcagcccttgtgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgac
cacccattaattcagttccagtatatccggaactgtgtaatgaataggaccttgccccat
tttatacttgtggaatgttgcaagatcaaaaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttccccttcctttaccaccaaagaaaacg
cgagttatttctcacatttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcacgtcagagctggcctttttcatggt
actgaacttctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatattaatacttgtgacctgccacgaatggctcgatta
tgttttgcagtttatgcagttttggataaagtgaaaacaaagaaatcaactaaaactatt
aatccctctaaatatcagaccatcaggaaatctgggaaagtgcattatccagtagcatgg
gtaaatacgatggtttttgactttaaaggacaattgagatctggagatgtaatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattaccctcccttcgataagattatcgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactcaaagaa
atcttggacagggatcccctgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgagacaagactgcagagagaatttcccacagtcactgccaaaattattgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctacccccccgggaggccctggagcttctagatttcaactatccagatcagtacgtgcgg
gaatatgctgtgaactgcctgcgacagatgagcgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttttggattgtgccctctctagattccta
ttagaaagagcacttgccaatcggaggatagggcagtttctattttggcacctcaggtca
gaagtgcacattcctgctgtctctgtgcaatttggtgtcattcttgaagcatactgccgg
gggagcgtagggcacatgaaagtgctttccaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagctaaacagagccaaagggaaagag
gccatgcacacctgtttaaaacagaatgcttaccgggaggccctctctgacctgcagtca
cctctgaacccgtgtgtcatcctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctggtgtacaccaacaaggtgtttggggaagattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccagatgctg
cgcttgatggatttgctctggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaataaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaagag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttggaattggtgacaga
catagcgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccaatgttgtgaggatgcgtatctgattttacgacgacatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccctagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtaaactggatg
gcccacacagtccggaaagactaccgatcttaa

KEGG   Equus caballus (horse): 100052122
Entry
100052122         CDS       T01058                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100052122
   04014 Ras signaling pathway
    100052122
   04015 Rap1 signaling pathway
    100052122
   04370 VEGF signaling pathway
    100052122
   04630 JAK-STAT signaling pathway
    100052122
   04668 TNF signaling pathway
    100052122
   04066 HIF-1 signaling pathway
    100052122
   04068 FoxO signaling pathway
    100052122
   04070 Phosphatidylinositol signaling system
    100052122
   04072 Phospholipase D signaling pathway
    100052122
   04071 Sphingolipid signaling pathway
    100052122
   04024 cAMP signaling pathway
    100052122
   04151 PI3K-Akt signaling pathway
    100052122
   04152 AMPK signaling pathway
    100052122
   04150 mTOR signaling pathway
    100052122
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100052122
  09143 Cell growth and death
   04210 Apoptosis
    100052122
   04218 Cellular senescence
    100052122
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100052122
   04550 Signaling pathways regulating pluripotency of stem cells
    100052122
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100052122
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100052122
   04613 Neutrophil extracellular trap formation
    100052122
   04620 Toll-like receptor signaling pathway
    100052122
   04625 C-type lectin receptor signaling pathway
    100052122
   04650 Natural killer cell mediated cytotoxicity
    100052122
   04660 T cell receptor signaling pathway
    100052122
   04662 B cell receptor signaling pathway
    100052122
   04664 Fc epsilon RI signaling pathway
    100052122
   04666 Fc gamma R-mediated phagocytosis
    100052122
   04670 Leukocyte transendothelial migration
    100052122
   04062 Chemokine signaling pathway
    100052122
  09152 Endocrine system
   04910 Insulin signaling pathway
    100052122
   04923 Regulation of lipolysis in adipocytes
    100052122
   04929 GnRH secretion
    100052122
   04915 Estrogen signaling pathway
    100052122
   04914 Progesterone-mediated oocyte maturation
    100052122
   04917 Prolactin signaling pathway
    100052122
   04926 Relaxin signaling pathway
    100052122
   04935 Growth hormone synthesis, secretion and action
    100052122
   04919 Thyroid hormone signaling pathway
    100052122
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100052122
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100052122
  09156 Nervous system
   04725 Cholinergic synapse
    100052122
   04722 Neurotrophin signaling pathway
    100052122
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100052122
  09158 Development and regeneration
   04360 Axon guidance
    100052122
   04380 Osteoclast differentiation
    100052122
  09149 Aging
   04211 Longevity regulating pathway
    100052122
   04213 Longevity regulating pathway - multiple species
    100052122
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100052122
   05206 MicroRNAs in cancer
    100052122
   05205 Proteoglycans in cancer
    100052122
   05203 Viral carcinogenesis
    100052122
   05230 Central carbon metabolism in cancer
    100052122
   05231 Choline metabolism in cancer
    100052122
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100052122
  09162 Cancer: specific types
   05210 Colorectal cancer
    100052122
   05212 Pancreatic cancer
    100052122
   05225 Hepatocellular carcinoma
    100052122
   05226 Gastric cancer
    100052122
   05214 Glioma
    100052122
   05221 Acute myeloid leukemia
    100052122
   05220 Chronic myeloid leukemia
    100052122
   05218 Melanoma
    100052122
   05211 Renal cell carcinoma
    100052122
   05215 Prostate cancer
    100052122
   05213 Endometrial cancer
    100052122
   05224 Breast cancer
    100052122
   05222 Small cell lung cancer
    100052122
   05223 Non-small cell lung cancer
    100052122
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100052122
   05017 Spinocerebellar ataxia
    100052122
   05020 Prion disease
    100052122
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100052122
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100052122
   04932 Non-alcoholic fatty liver disease
    100052122
   04931 Insulin resistance
    100052122
   04933 AGE-RAGE signaling pathway in diabetic complications
    100052122
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100052122
   05100 Bacterial invasion of epithelial cells
    100052122
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100052122
   05170 Human immunodeficiency virus 1 infection
    100052122
   05161 Hepatitis B
    100052122
   05160 Hepatitis C
    100052122
   05171 Coronavirus disease - COVID-19
    100052122
   05164 Influenza A
    100052122
   05162 Measles
    100052122
   05168 Herpes simplex virus 1 infection
    100052122
   05163 Human cytomegalovirus infection
    100052122
   05167 Kaposi sarcoma-associated herpesvirus infection
    100052122
   05169 Epstein-Barr virus infection
    100052122
   05165 Human papillomavirus infection
    100052122
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100052122
   05142 Chagas disease
    100052122
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100052122
   01524 Platinum drug resistance
    100052122
   01522 Endocrine resistance
    100052122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100052122
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100052122
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF5638 Transcrip_act Fez1 Cupin_8
Other DBs
NCBI-GeneID: 100052122
NCBI-ProteinID: XP_023486548
LinkDB
Position
2
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSGISNGIKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLTYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDESLPHYDEKTWFV
EDINRVQAEDLLCGKPDGAFLIRESSKEGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcaggcatttcaaatggaataaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacga
gacatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattac
actttgactttgcggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatatggcttttctgatcctctgacctttaattctgtggtggagctcattaaccactat
catcacgaatctctggctcagtacaatcccaaacttgatgtgaagctgacgtacccggtg
tccaggtaccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaaa
ctgcaagagtaccactctcagtatcaggaaaagagtaaagagtatgacaggctatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagtaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaagcctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttgtgggaagcctgatggcgcattc
ttaatccgtgagagcagcaaggaaggatgctatgcttgctctgtggttgccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcggagccctacaac
ctgtacagctcactgaaggagctggtgctccattaccagcagacatcgctcgttcagcac
aacgactcgctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcactctgc
agataa

KEGG   Equus caballus (horse): 100058141
Entry
100058141         CDS       T01058                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100058141 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100058141 (PIK3CA)
   04014 Ras signaling pathway
    100058141 (PIK3CA)
   04015 Rap1 signaling pathway
    100058141 (PIK3CA)
   04370 VEGF signaling pathway
    100058141 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100058141 (PIK3CA)
   04668 TNF signaling pathway
    100058141 (PIK3CA)
   04066 HIF-1 signaling pathway
    100058141 (PIK3CA)
   04068 FoxO signaling pathway
    100058141 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100058141 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100058141 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100058141 (PIK3CA)
   04024 cAMP signaling pathway
    100058141 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100058141 (PIK3CA)
   04152 AMPK signaling pathway
    100058141 (PIK3CA)
   04150 mTOR signaling pathway
    100058141 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100058141 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100058141 (PIK3CA)
   04218 Cellular senescence
    100058141 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100058141 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100058141 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100058141 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100058141 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    100058141 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100058141 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100058141 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100058141 (PIK3CA)
   04660 T cell receptor signaling pathway
    100058141 (PIK3CA)
   04662 B cell receptor signaling pathway
    100058141 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100058141 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100058141 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100058141 (PIK3CA)
   04062 Chemokine signaling pathway
    100058141 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100058141 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100058141 (PIK3CA)
   04929 GnRH secretion
    100058141 (PIK3CA)
   04915 Estrogen signaling pathway
    100058141 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100058141 (PIK3CA)
   04917 Prolactin signaling pathway
    100058141 (PIK3CA)
   04926 Relaxin signaling pathway
    100058141 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100058141 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100058141 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100058141 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100058141 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100058141 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100058141 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100058141 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100058141 (PIK3CA)
   04380 Osteoclast differentiation
    100058141 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100058141 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100058141 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058141 (PIK3CA)
   05206 MicroRNAs in cancer
    100058141 (PIK3CA)
   05205 Proteoglycans in cancer
    100058141 (PIK3CA)
   05203 Viral carcinogenesis
    100058141 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100058141 (PIK3CA)
   05231 Choline metabolism in cancer
    100058141 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100058141 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100058141 (PIK3CA)
   05212 Pancreatic cancer
    100058141 (PIK3CA)
   05225 Hepatocellular carcinoma
    100058141 (PIK3CA)
   05226 Gastric cancer
    100058141 (PIK3CA)
   05214 Glioma
    100058141 (PIK3CA)
   05221 Acute myeloid leukemia
    100058141 (PIK3CA)
   05220 Chronic myeloid leukemia
    100058141 (PIK3CA)
   05218 Melanoma
    100058141 (PIK3CA)
   05211 Renal cell carcinoma
    100058141 (PIK3CA)
   05215 Prostate cancer
    100058141 (PIK3CA)
   05213 Endometrial cancer
    100058141 (PIK3CA)
   05224 Breast cancer
    100058141 (PIK3CA)
   05222 Small cell lung cancer
    100058141 (PIK3CA)
   05223 Non-small cell lung cancer
    100058141 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100058141 (PIK3CA)
   05017 Spinocerebellar ataxia
    100058141 (PIK3CA)
   05020 Prion disease
    100058141 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100058141 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100058141 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100058141 (PIK3CA)
   04931 Insulin resistance
    100058141 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100058141 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100058141 (PIK3CA)
   05135 Yersinia infection
    100058141 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100058141 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100058141 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100058141 (PIK3CA)
   05161 Hepatitis B
    100058141 (PIK3CA)
   05160 Hepatitis C
    100058141 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100058141 (PIK3CA)
   05164 Influenza A
    100058141 (PIK3CA)
   05162 Measles
    100058141 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100058141 (PIK3CA)
   05163 Human cytomegalovirus infection
    100058141 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100058141 (PIK3CA)
   05169 Epstein-Barr virus infection
    100058141 (PIK3CA)
   05165 Human papillomavirus infection
    100058141 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100058141 (PIK3CA)
   05142 Chagas disease
    100058141 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100058141 (PIK3CA)
   01524 Platinum drug resistance
    100058141 (PIK3CA)
   01522 Endocrine resistance
    100058141 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100058141 (PIK3CA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100058141 (PIK3CA)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100058141 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 100058141
NCBI-ProteinID: XP_001494991
Ensembl: ENSECAG00000015019
VGNC: 21446
UniProt: F6VFI8
LinkDB
Position
19
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccgagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggcc
acattaataactataaagcatgaactatttaaagaagcgagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacgagaagactttgtgaccttcggctttttcaaccctttttaaaa
gttattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggctttgct
attggtatgccagtgtgtgaatttgatatggttaaagatccagaagtgcaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctaccctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcaaaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacagctaaaa
ctgtgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcttagaaaaatatcctctcagtcaatataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccagatggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggcagaaagggtgctaaagaggaacattgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacaactacgagcaatttgtacgcgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctgcccaaattgcttctgtccgttaagtggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgcaattacccagaccctatggttcgcggttttgctgttcgatgcttggaa
aaatatttaacagatgacaaactttctcagtacttaattcagctagtgcaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaagtctgagatgcacaataaaacagtc
agtcagaggtttggcctgcttttggagtcctattgtcgtgcatgtggaatgtatttaaag
cacctgaatcggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcagatgcgg
cgaccagatttcatggatgctctgcagggctttctgtctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgccaagaggccgctgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggtgatgatttacggcaagatatgctaacacttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttacggttgtctgtca
attggtgactgcgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaagggtgcacttcagttcaacagccacacgctacaccagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgatctgtttacacgttcg
tgtgctggatattgtgtcgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagatgatggacaactgtttcatatagactttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccttagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacaccatggtggatggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Equus caballus (horse): 100146348
Entry
100146348         CDS       T01058                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100146348 (PIK3R2)
   04014 Ras signaling pathway
    100146348 (PIK3R2)
   04015 Rap1 signaling pathway
    100146348 (PIK3R2)
   04370 VEGF signaling pathway
    100146348 (PIK3R2)
   04630 JAK-STAT signaling pathway
    100146348 (PIK3R2)
   04668 TNF signaling pathway
    100146348 (PIK3R2)
   04066 HIF-1 signaling pathway
    100146348 (PIK3R2)
   04068 FoxO signaling pathway
    100146348 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100146348 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100146348 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100146348 (PIK3R2)
   04024 cAMP signaling pathway
    100146348 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100146348 (PIK3R2)
   04152 AMPK signaling pathway
    100146348 (PIK3R2)
   04150 mTOR signaling pathway
    100146348 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100146348 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100146348 (PIK3R2)
   04218 Cellular senescence
    100146348 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100146348 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100146348 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100146348 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100146348 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    100146348 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100146348 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100146348 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100146348 (PIK3R2)
   04660 T cell receptor signaling pathway
    100146348 (PIK3R2)
   04662 B cell receptor signaling pathway
    100146348 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100146348 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100146348 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100146348 (PIK3R2)
   04062 Chemokine signaling pathway
    100146348 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100146348 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100146348 (PIK3R2)
   04929 GnRH secretion
    100146348 (PIK3R2)
   04915 Estrogen signaling pathway
    100146348 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100146348 (PIK3R2)
   04917 Prolactin signaling pathway
    100146348 (PIK3R2)
   04926 Relaxin signaling pathway
    100146348 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    100146348 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100146348 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100146348 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100146348 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100146348 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100146348 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100146348 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100146348 (PIK3R2)
   04380 Osteoclast differentiation
    100146348 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100146348 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100146348 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100146348 (PIK3R2)
   05206 MicroRNAs in cancer
    100146348 (PIK3R2)
   05205 Proteoglycans in cancer
    100146348 (PIK3R2)
   05203 Viral carcinogenesis
    100146348 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100146348 (PIK3R2)
   05231 Choline metabolism in cancer
    100146348 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100146348 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100146348 (PIK3R2)
   05212 Pancreatic cancer
    100146348 (PIK3R2)
   05225 Hepatocellular carcinoma
    100146348 (PIK3R2)
   05226 Gastric cancer
    100146348 (PIK3R2)
   05214 Glioma
    100146348 (PIK3R2)
   05221 Acute myeloid leukemia
    100146348 (PIK3R2)
   05220 Chronic myeloid leukemia
    100146348 (PIK3R2)
   05218 Melanoma
    100146348 (PIK3R2)
   05211 Renal cell carcinoma
    100146348 (PIK3R2)
   05215 Prostate cancer
    100146348 (PIK3R2)
   05213 Endometrial cancer
    100146348 (PIK3R2)
   05224 Breast cancer
    100146348 (PIK3R2)
   05222 Small cell lung cancer
    100146348 (PIK3R2)
   05223 Non-small cell lung cancer
    100146348 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100146348 (PIK3R2)
   05017 Spinocerebellar ataxia
    100146348 (PIK3R2)
   05020 Prion disease
    100146348 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100146348 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100146348 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    100146348 (PIK3R2)
   04931 Insulin resistance
    100146348 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100146348 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100146348 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    100146348 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100146348 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100146348 (PIK3R2)
   05161 Hepatitis B
    100146348 (PIK3R2)
   05160 Hepatitis C
    100146348 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    100146348 (PIK3R2)
   05164 Influenza A
    100146348 (PIK3R2)
   05162 Measles
    100146348 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100146348 (PIK3R2)
   05163 Human cytomegalovirus infection
    100146348 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100146348 (PIK3R2)
   05169 Epstein-Barr virus infection
    100146348 (PIK3R2)
   05165 Human papillomavirus infection
    100146348 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100146348 (PIK3R2)
   05142 Chagas disease
    100146348 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100146348 (PIK3R2)
   01524 Platinum drug resistance
    100146348 (PIK3R2)
   01522 Endocrine resistance
    100146348 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100146348 (PIK3R2)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100146348 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 ATG11 SH3_1 Ribosomal_L22e SH3_2 Tai4
Other DBs
NCBI-GeneID: 100146348
NCBI-ProteinID: XP_023481250
LinkDB
Position
21
AA seq 723 aa
MAGAEGFQYRALYRFRRERPEDLELLPGDVLVVSRAALQALGVAEGSERCPQSVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDAAPPILVKLVEAIEQTGLDGDSLYRPEPPAPRTDWSLSDVEQWDAAALSDGVKGFLLA
LPAPLVTPEAAAEAHRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRLARRAPAPG
PAVRALGAAFGPLLLRAPPPSPPPGGAPDGTEPGPDFPGLLVEKLLQEHLEEQEVAPPAL
PPKPPKAKPAPTGVANGGSLPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFGSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLRVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEEDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLRELVLHYQHTSLLQHNDALAVTLAHPVRAPAPA
PAR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggctggtgctgaaggcttccaataccgggcgctttaccggttccgccgggagcggccc
gaggacctagagctgctgccgggcgacgtgctggtggtgagccgggcagccttgcaggcg
ctgggcgtggcggagggcagtgagcgctgcccgcagagtgtgggctggatgcctggcttc
aacgagcgcacgcggcagcgtggcgacttccccggcacctacgttgagttcctggggccc
gtggccctggcccggcctggccctcgcccccgaggcccccgcccactgcctgccaggccc
cgagatggacccccggagccaggcctcacactccccgacctgcctgagcagttctcccca
cctgatgcggctcctcccatcctggtgaagctcgtggaagccattgagcagacagggcta
gacggtgactccctctacaggccggagccgcccgccccgcgcacagactggtccctgagc
gacgtggagcagtgggacgcggccgctctgtcagacggcgtcaagggtttcctgctggcg
ctgcccgcgcccctcgtgacgcccgaggcggcggccgaggcgcaccgggccctgagggag
gccgcggggcccgtgggaccggcgctggagccgccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgcctggcgcggcgcgcccccgccccgggc
cccgccgtgcgcgcgctgggcgcggccttcgggccgctgctgctgcgcgcgccgccgccc
tcgccgccgccagggggcgcgcccgacggcactgagcccggcccagacttcccagggctg
ctggtggagaagttgcttcaggagcatctggaggagcaggaggtggcacccccagcacta
ccacctaaaccccccaaggcaaagccggcccccacaggtgtggccaatggggggagcctg
ccctccctgcaggatgctgagtggtactggggcgacatctccagggaggaggtgaatgag
aaactccgggacacgcctgatggcacctttctggtccgagatgcctccagcaagatccag
ggggagtacacgctgaccctcaggaaaggcgggaacaacaagctgattaaagttttccac
cgtgacgggcactatggcttctcggagccgctgaccttcggctccgtggtggatctcatc
acccactaccgccatgagtcgttggcccagtacaacgccaaactggacacgcggctcctc
taccccgtgtccaagtaccagcaggaccagatcgtcaaggaggacagcgtggaggcggtg
ggtgctcagctcagggtctaccaccagcagtaccaggacaagagccgcgagtacgaccag
ctgtacgaggagtacacgcgcacctcccaggaactgcagatgaagcgcacagcaattgaa
gctttcaatgagacgattaagatctttgaagagcagggccagacacaagagaagtgcagc
aaggaatatctggagcgcttccggcgtgagggcaatgagaaggagatgcaaaggatcctg
ctgaactcagagcggctcaagtctcgcatcgctgagatccacgagagccgcacaaagctg
gagcaggagctgcgtgcacaggcctcagacaaccgggagattgacaagcgcatgaacagc
ctcaagccagacctcatgcagctgcgcaagatccgagaccagtacctcgtgtggcttacc
cagaaaggcgcccggcagaagaaaatcaacgagtggttggggatcaaaaacgagactgag
gaccaatatgcgctgatggaggatgaggaggacctcccccaccatgaggagcgcacgtgg
tatgtgggcaagatcaaccgcacgcaggccgaagaaatgctgagtggcaagcgggatggc
accttcctcatccgcgagagcagccagcggggctgctatgcctgctcggtggtggtggac
ggcgacaccaagcactgcgtcatctaccgcacggccacgggcttcggcttcgcggagccc
tacaacctgtacggctcgctgcgggagctggtgctgcactaccagcacacgtcgctgctg
cagcacaacgacgcgctcgccgtcacgctcgcccacccggtgcgcgcgcccgcgcccgcg
cccgcgcgctga

DBGET integrated database retrieval system