KEGG   Equus caballus (horse): 100050247Help
Entry
100050247         CDS       T01058                                 

Gene name
NAPEPLD
Definition
(RefSeq) N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100050247 (NAPEPLD)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     100050247 (NAPEPLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 100050247
NCBI-ProteinID: XP_001488814
Ensembl: ENSECAG00000011986
VGNC: 20561
LinkDB All DBs
Position
4
AA seq 391 aa AA seqDB search
MDENESSQSLMTSSQYPKEAVRKRQNSARSSGGSDSSRFSRKSFKLDYRLEEDVTKSKKG
KDGRFVNPWPSWKNLSIPNVLRWLIMEKDHSGVPSSKEELDKELPVLKPYFVDDPEQAGV
REAGLRVTWLGHATVMVEMDELVLLTDPVFSSRASPSQYVGPKRFRRPPCTVNELPRVDA
VLISHNHYDHLDHNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPG
RDKVTFVLTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCSGFEEIGRRFGP
FDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHIDVQAKKSVAIHWGTFALANEHYLEPPLK
LSEALERYGLKTEDFFVLKHGESRYLNTDEN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaatgaaagcagccagtccctgatgacaagcagccaataccccaaagaagca
gtaagaaaacgccagaattcagcacggagttctggcgggagcgattcttcaaggttctcc
aggaaaagtttcaaactggattacagactagaggaagatgtcaccaagtcaaagaaaggg
aaggatggaagatttgtcaacccttggccatcgtggaaaaatctgtctattccaaatgtc
ctcagatggctgataatggagaaagatcacagcggtgttcccagctccaaagaggagctt
gataaagaactcccagtgctgaaaccgtattttgtcgatgaccctgaacaagctggcgtg
agggaagctggcttacgagtcacgtggctgggacacgcgacggtcatggtggagatggat
gagctggttcttctcacggaccccgtcttcagctcccgcgcctcgccgtcgcagtacgtg
ggtccgaagcgtttccgtcgacccccgtgcactgtgaacgaactgccccgggtagacgcg
gtccttatcagccacaaccactatgaccacctggaccacaactctgtcatcgctctgaac
gagcggttcgggaatgagttgcgatggtttgtgcctttgggtctcctcgactggatgcag
aaatgtggctgtgagaacgtgattgagctggactggtgggaggagaactgtgtccctgga
cgcgacaaggtcaccttcgtcctcacgccttcccagcactggtgtaagaggactctgatg
gatgacaacaaggtgctctggggcagctggtctgtcctggggccttggaatcgatttttt
ttcgcaggagacactggttattgctctggttttgaagagataggaagaagatttgggcct
tttgacctggctgctattcccattggagcttatgaaccaaggtggtttatgaaataccag
cacgtagacccggaagaagctgtaaggattcacattgacgttcaagcgaagaaatctgtg
gccattcactgggggacgtttgccttggcgaatgagcattacttagagcccccactgaaa
ctgagtgaggctctagaaagatacggacttaagactgaagatttttttgtcttgaagcat
ggagaatcaagataccttaacactgatgaaaactga

DBGET integrated database retrieval system