KEGG   Equus caballus (horse): 100050436
Entry
100050436         CDS       T01058                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17 isoform X2
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100050436 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050436 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    100050436 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100050436 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100050436 (ZBTB17)
   04121 Ubiquitin system [BR:ecb04121]
    100050436 (ZBTB17)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100050436 (ZBTB17)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100050436 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 Zn-ribbon_8 zinc_ribbon_15 zf_UBZ zf-BED zf-Di19 zf-C2HE XPA_N Packaging_FI zf-C2HC_2 HypA DUF3268
Other DBs
NCBI-GeneID: 100050436
NCBI-ProteinID: XP_001489171
Ensembl: ENSECAG00000024826
VGNC: 25135
LinkDB
Position
2
AA seq 794 aa
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSSENVDDVLAVASFLQMQDIITACHALKSLAELAAS
PGENTEVSAMEGGDKRAKEEKAAATMLSELDPAGSSPPTGPGREPKEERGGQAESAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEELEEEGAAP
AAVKEEGPQQQKGEAPEESEESASTDSGQELGAEARGLRSGTYGDRTESKAYGSVIHKCE
DCGKEFTHTGNFKRHIRIHTGEKPFSCRECNKAFSDPAACKAHEKTHSPLKPYGCEECGK
SYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSD
PTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNL
KRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHV
RQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHT
GEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEA
LAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDA
NSLAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQVLQAGELVFRPRDGADGQPALA
ETPPTAPECPPPAE
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggattttccccagcacagccagcatgtcttggagcagctgaaccagcagcggcagctg
gggcttttgtgtgactgcacttttgtggtggacggcgtcgactttaaggcccataaagca
gtgctggcggcttgcagcgagtacttcaagatgctcttcgtggaccagaaggatgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacagcc
aagctgagcctgagctctgagaacgtggacgatgtgctggctgtggccagcttcctgcag
atgcaggacatcatcacagcctgccatgccctcaagtcacttgctgagctggccgccagc
cctggggagaatacagaggtctcagccatggaaggaggggacaagagagccaaagaggaa
aaggctgctgccaccatgctgagtgagctagacccggccggaagcagtccacccacgggc
ccaggcagagagcccaaagaggagcgaggcggccaggccgagagcgcggccagtggtgca
gaacagacggagaaggctgatgccccccgggagccgccacccgtggagctcaagcctgac
cccacgagtggcatggctgctgctgaagccgaggcggccttgtcagagagctcggagcaa
gaaatggaggtggagccagccaggaagggagaagagctggaggaggagggtgccgcgcca
gctgccgtcaaggaagaggggccgcagcagcagaagggggaggctcctgaggagagcgag
gagtcagcgagcacggactcgggccaggagctcggggcggaggcccggggcctgcgctcg
ggcacctacggcgaccgcacggagtccaaggcctatggctccgtcatccacaagtgtgag
gactgtgggaaggagttcacgcacacagggaacttcaagcggcacatccgcatccacacg
ggggagaagcccttctcctgccgggagtgcaacaaggctttctccgacccggctgcgtgc
aaggcccacgagaagactcacagcccgctgaagccctatggctgcgaggagtgcggcaag
agctaccggctcatcagcctgctgaacctgcacaagaagcggcactcgggcgaggcgcgc
taccgctgcgaggactgcggcaagctcttcaccacctcgggcaacctcaagcggcaccag
ctggtgcacagcggcgagaagccctaccagtgtgactactgcggccggtccttctccgac
cccacctccaagatgcgccacctggagacccacgacaccgacaaggagcacaagtgccca
cactgcgacaagaagttcaaccaggtggggaatctgaaggcccacctgaagatccacatc
gcggatgggcccctcaagtgccgagagtgtgggaagcagttcaccacctcagggaacctc
aagcggcatcttcggatccacagtggggagaagccctacgtgtgcatccactgccagcgg
cagtttgctgaccctggcgctctgcagcggcacgtccgtatccacacgggtgagaaacca
tgccagtgcgtgatgtgcggcaaggcctttacccaggccagctccctcatcgcccacgtg
cgccagcacactggggagaagccttatgtctgcgaacgctgtggcaagagatttgtccag
tccagccagttggccaatcacattcgccaccatgacaacatccgcccgcacaagtgcagc
gtgtgcagcaaggccttcgtgaacgtgggggacctctccaagcacatcattatccatact
ggagagaagccctacctctgtgacaagtgcggtcgtggcttcaaccgggtggacaatctg
cgttcccacgtgaagaccgtgcaccaggggaaggcaggcatcaaaatcctggagccagag
gagggtggtgaggtcagcgtggtcactgttgatgacatggtcacgctggccaccgaggca
ctggcagcaacagctgtcactcagctcacagtggtaccggtgggggctgcggtgactgcc
gatgagacagaagtactgaaagctgagatcagcaaggctgtgaagcaagtgcaggaagaa
gaccccaacacccacatcctctatgcctgtgactcctgtggggacaagttcctggatgcc
aacagcctggctcagcacgtgcggatccacacggcccaggcattggtcatgttccagaca
gatgcggacttctaccagcagtacgggccaggcagcacgtggccagccgggcaggtgttg
caggctggggagctggtcttccgccctcgggatggggccgacggccagcctgctctggca
gagacgccgcccacagctcctgaatgtccaccgcctgccgagtga

DBGET integrated database retrieval system