KEGG   Equus caballus (horse): 100050542
Entry
100050542         CDS       T01058                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin heavy chain isoform X1
  KO
K10396  kinesin family member 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04144  Endocytosis
ecb04728  Dopaminergic synapse
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100050542 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100050542 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100050542 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100050542 (KIF5A)
   05012 Parkinson disease
    100050542 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    100050542 (KIF5A)
   05016 Huntington disease
    100050542 (KIF5A)
   05020 Prion disease
    100050542 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100050542 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100050542 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100050542 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100050542 (KIF5A)
   04147 Exosome [BR:ecb04147]
    100050542 (KIF5A)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100050542 (KIF5A)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100050542 (KIF5A)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100050542 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Other DBs
NCBI-GeneID: 100050542
NCBI-ProteinID: XP_023499640
Ensembl: ENSECAG00000006866
VGNC: 19421
LinkDB
Position
6
AA seq 1032 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDATLGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVSEVALKDKEPDTQDTDEVKKVLEVQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKNEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
AAPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KVFPLHQETAAS
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgatttcggcccttgaac
caggcagagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccgtatgtctttgaccgtgtattccccccaaacacgactcaggag
caggtttatcatgcatgtgccatgcagatcgtcaaagatgtccttgctggctacaatggc
accatttttgcttatggacagacatcctcagggaaaacacataccatggagggaaagctg
catgacccccaactgatgggaatcattcctcgaattgcccgagacatcttcaaccatatc
tactccatggatgagaacctcgagttccacatcaaggtttcttactttgagatttacctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatctgtctgtgcacgaggacaag
aaccgggtgccatttgtcaagggttgtactgaacgctttgtgtccagccctgaggagatt
ttagatgtgattgatgaggggaaatcgaatcgtcatgtggctgtcaccaacatgaatgaa
cacagctctcgaagccacagcatcttcctcatcaacatcaagcaggagaatatggagact
gagcagaagctcagtgggaagctgtacctagtggacctggcagggagtgagaaggtcagc
aagactggagcagagggagccgtgctggacgaggcaaagaatatcaacaagtccctgtca
gccctggggaatgtgatctccgcactggccgagggcactaaaacctacgtcccatatcgt
gacagcaaaatgacccggattctccaggactccctgggaggaaactgccggaccactatg
ttcatctgttgctcaccatccagctacaacgatgcagagaccaagtccaccctgatgttt
gggcagcgggcaaagaccattaagaacactgcctcagtgaatctggagttgactgccgaa
cagtggaagaagaaatatgagaaggaaaaggagaagacgaaggctcagaaggagactatc
gcaaagctggaggctgagctgagccggtggcgcaacggagagaatgtgcctgagactgag
cgcctggccggggaggatgcaaccctgggagccgagctctgtgaggagacacctgtgaat
gacaactcatccatcgtggtgcgcatcgcgcccgaggagcggcagaaatatgaggaggag
atccgccgcctctacaagcagcttgacgacaaggatgatgagatcaaccagcagagccag
ctcatagagaagctcaagcagcaaatgctggaccaggaagagctgctggtgtccacccga
ggagacaatgagaaggtccagcgggagctgagccacctgcagtcggagaacgatgctgca
aaggatgaggtgaaggaagtgctgcaggccctggaggagctggccgtgaactatgaccag
aagtcccaggaggtggaggaaaagagccagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgagttgcagcggctacaggaggtcagt
ggacaccagcgaaaacgaatcgctgaggtgctgaacgggctgatgaaggacctgagtgag
ttcagtgtcatcgtgggcaacggggagattaagctgccggtggagatcagcggggccatc
gaggaggagttcaccgtggcccgactttacatcagcaaaatcaaatcagaagtcaagtct
gtggtcaagcggtgccggcagctggagaacctgcaggttgaatgtcatcgcaagatggaa
gtgactgggcgggagctctcgtcctgccagctcctcatctcccagcacgaggccaagatc
cgctcgctcacggaatacatgcagagtgtggagctgaagaagcggcacctggaagagtcc
tatgactccctgagtgatgagctggccaagctccaggcccaggaaactgtgagtgaagtg
gccctgaaggacaaggaaccagacacacaagatacagacgaagtaaagaaggtcctggag
gtgcagatggaaagtcaccgggaggcccatcaccgtcagctggctcggctccgggacgag
atcaatgagaagcagaagaccattgatgagctcaaagacctgaatcagaagctccagttg
gagctagagaaacttcaggctgactacgagaagctgaagaatgaagagcatgagaagagc
accaaactccaggagctgacatttctgtacgagcgacacgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaaactg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggccgttcggtacaagagctccggcaagcgcggccattccgcccagattgccaaa
cctgtccggcctggccactacccggcgtcttcacccaccaacccctatggcacccggagc
cctgagtgcatcagttacaccaacagcctcttccagaattaccagaatttgtacctgcag
gccgcacctagctccacctcagatatgtactttgcaaactcctgtaccagcagtggggcc
acatcttctggtggccccttggcatcctaccagaaggccaacatggacaatggaaatgcc
acagatatcaacgacaataggagtgacctgccgtgcggctatgaggctgaggaccaggcc
aaggttttccctctccaccaagagacggcagccagctaa

KEGG   Equus caballus (horse): 100056413
Entry
100056413         CDS       T01058                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain isoform X1
  KO
K10396  kinesin family member 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04144  Endocytosis
ecb04728  Dopaminergic synapse
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100056413 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100056413 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100056413 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100056413 (KIF5C)
   05012 Parkinson disease
    100056413 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    100056413 (KIF5C)
   05016 Huntington disease
    100056413 (KIF5C)
   05020 Prion disease
    100056413 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    100056413 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100056413 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100056413 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100056413 (KIF5C)
   04147 Exosome [BR:ecb04147]
    100056413 (KIF5C)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100056413 (KIF5C)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100056413 (KIF5C)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100056413 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 100056413
NCBI-ProteinID: XP_023478621
Ensembl: ENSECAG00000013822
VGNC: 19423
LinkDB
Position
18
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPSTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVI
QHLEMELNRWRNGEAVPEEEQISAKDQKTLEPCDNTPILDNIAPVVAGISAEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTARVKKSVELDSDDGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGGSSNSTHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gcggagatcctccgcggggacaaattcatccccaaatttaaaggcgatgagactgtggtg
atcgggcaagggaagccatatgtcttcgacagagtgctgcctcccagcacgacccaagag
caggtttacaatgcgtgtgcaaagcaaattgtcaaagatgtccttgaaggttataatggg
acgatttttgcgtatggacagacttcatcaggaaaaacacacaccatggaggggaagctc
catgaccctcagctcatggggatcatcccgaggatcgcacacgatatctttgaccatatc
tattccatggatgaaaacctggagtttcacatcaaggtttcctattttgagatctacttg
gacaaaatcagggacttactcgatgtatccaagacaaacttggctgttcatgaagataaa
aacagagtcccatacgtaaaggggtgcaccgagcggtttgtatcaagccccgaggaagtc
atggatgtgatagatgaaggcaaagcaaaccgacatgtggctgtaacaaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtgggaagctttatctagttgatttggctgggagtgaaaaggtcagt
aaaactggtgccgagggagctgttctcgatgaagctaaaaatatcaataaatctttgtct
gctcttggaaacgtgatctctgccttggcagaaggaacaaaaacacacgtgccgtaccgg
gacagcaagatgactcggattcttcaggactctctgggtgggaactgtagaaccaccatc
gttatttgctgttctccctctgtcttcaatgaagctgagaccaagtcaacgctgatgttt
ggacaaagggctaagaccatcaagaatacagtctctgtgaacctggaactgacagcggaa
gaatggaagaagaaatatgaaaaagagaaagagaaaaacaagactttgaagaatgttatc
cagcatctggagatggagctaaatagatggagaaatggagaagctgtgcctgaggaagaa
cagatcagtgctaaggaccagaagaccctggagccctgtgataacacccccatcttagac
aacattgctcctgttgttgccggcatctctgcagaggagaaggagaagtacgacgaggag
atctccagtctctacagacaactggatgataaggatgatgaaattaaccagcagagccag
ctggctgaaaagctaaagcaacagatgttggatcaggatgagcttttagcttccacaaga
agagactatgagaagatccaggaggagctgacacgtctccagattgaaaacgaggcagcc
aaagatgaagtgaaggaagttctccaggccctggaggagctggctgtcaattatgaccag
aagtcacaggaagtggaggacaagaccagagccaatgagcagctgacagatgaactggcc
caaaaaacgactacgttgacaaccacacagagagagctgagccagctacaagagctaagc
aaccaccagaaaaagagagccaccgagatcctgaatttgctgctgaaggatctaggggag
atcggtgggattattggcaccaacgatgtgaagactttggcagatgtgaatggagtcatt
gaggaggaattcaccatggcccgtctgtacatcagcaagatgaagtcggaggtcaagtcg
ctggtgaaccgcagcaaacagctcgagagcgcccagatggactccaacaggaagatgaat
gccagcgagcgggagctggcagcgtgccagctgctcatctcccagcatgaagccaagatc
aaatccctgacagactacatgcagaacatggaacagaagaggaggcagctggaggagtcc
caagactcgctcagtgaagagctggctaagctccgagcccaagaaaaaatgcacgaggtc
agcttccaggataaggaaaaggaacatctgacgcgcctgcaggatgctgaggaaatgaag
aaggcactggagcagcagatggagagccaccgggaagcccaccagaagcagctttccaga
cttcgagatgaaattgaggagaagcagaaaatcattgatgagattcgggatttgaatcag
aaactgcaactggaacaagagaagctcagctctgattataacaagctgaaaatagaggac
caggagagagagatgaagctggaaaagctcttattgctcaatgataaaagggaacaagcc
agagaggacctgaaagggctggaggagacagtgtctcgagaactgcagactctgcataat
ctccgtaaactctttgtccaggatctgaccgcccgggttaaaaaaagcgtagagctggac
agcgatgacggagggggcagtgctgcccagaagcagaaaatttccttcctggagaataac
ctggaacagctcactaaggttcacaaacagctggtgcgcgacaacgcagacctgcgctgt
gagctgcccaagctggagaagcggctgcgcgccacggcggagcgcgtcaaggccctggag
agcgcactgaaggaggccaaggagaacgccatgcgggaccgtaagcgctaccagcaggaa
gtggatcgcatcaaggaggccgtgcgagccaagaacatggccaggagggcccactcggcc
cagattgcgaagcccatccgccctggacactacccggcgtcgtctcccacggccgtccac
gccatccgagggggaggaggtggctcttcaaactccactcactaccagaaataa

KEGG   Equus caballus (horse): 100061228
Entry
100061228         CDS       T01058                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain
  KO
K10396  kinesin family member 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04144  Endocytosis
ecb04728  Dopaminergic synapse
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100061228 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100061228 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100061228 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100061228 (KIF5B)
   05012 Parkinson disease
    100061228 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    100061228 (KIF5B)
   05016 Huntington disease
    100061228 (KIF5B)
   05020 Prion disease
    100061228 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100061228 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100061228 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100061228 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100061228 (KIF5B)
   04147 Exosome [BR:ecb04147]
    100061228 (KIF5B)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100061228 (KIF5B)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100061228 (KIF5B)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100061228 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin
Other DBs
NCBI-GeneID: 100061228
NCBI-ProteinID: XP_023487997
Ensembl: ENSECAG00000000558
VGNC: 19422
LinkDB
Position
29
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSNTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEREKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTVDKDITITNDKPAATIGVTGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEIEAKEKLITDLQDQTQKMMLEQERLKVEHEKLKTTDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVTVRGGGG
KQV
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggccgagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgag
tctgaggtgaaccgcggcgataagtacgtcgccaagtttcagggagaagacacggtcatg
atcgcgtccaagccttatgcatttgatcgggtgttccagtcaaatacatctcaagagcaa
gtgtataatgactgtgcaaagaagattgttaaagacgtacttgagggatacaatggaaca
atatttgcatatggacagacatcttctgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggtattattccaagaattgtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatttatttggat
aagataagggacctcttagatgtttcaaagaccaacctttcagttcatgaagataaaaat
cgagttccctatgtaaaggggtgcacagagcgttttgtatgtagtccagatgaagttatg
gataccatagatgaaggaaaatctaacagacacgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaatgtaaaacaagagaacacacaaacggaa
cagaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggtgagtaaa
actggagctgaaggtgctgtgctggatgaagctaagaacatcaacaagtcgctttctgct
cttggaaatgtcatttctgctttggctgagggtagtacgtatgttccctatcgagatagt
aaaatgacaagaatccttcaagattcattaggtgggaactgtagaaccactattgtaatt
tgctgctccccatcatcgtacaatgaatctgaaacaaaatctacgctcctgtttggtcaa
agggccaaaacaattaagaacacagtttgtgtcaatgtagagttgactgcagaacagtgg
aaaaagaagtatgaaagagaaaaagaaaaaaataagaccttgcggaataccattcagtgg
cttgaaaatgaactcaacagatggcgtaatggagagacagtgcctattgatgaacagttt
gacaaagagaaagccaacttggaagctttcacagtggataaggatattactattaccaat
gataaacctgcagccacgattggagttactggaaactttactgatgctgaaagaagaaag
tgtgaagaagaaattgctaaattgtacaaacaacttgatgacaaggatgaagaaattaat
caacagagccagttggtagagaaactgaagacacaaatgttggatcaggaagagcttctg
gcatctactagaagggatcaagataatatgcaagctgagctgaatcgcctgcaggcagaa
aatgatgcctccaaagaagaagtgaaagaagttttacaagccttagaggaacttgctgtc
aattatgatcagaagtctcaggaagttgaagacaaaactaaggaatatgaattgcttagt
gatgaactgaatcaaaaatcagcaactttagcaagtatagatgctgagcttcagaaactt
aaggaaatgaccaaccaccagaaaaaacgagcagcagagatgatggcatctttactaaaa
gaccttgcagaaataggaattgctgtaggaaataatgatgtaaagcagcccgagggaact
ggcatgatagatgaagagttcactgttgcaaggctctacattagcaaaatgaagtcagaa
gtaaaaacaatggtaaaacgctgcaaacagttagaaagcacacagactgagagcaacaaa
aagatggaagaaaatgaaaaggagttagcagcctgccagcttcgcatctctcaacatgaa
gccaaaatcaagtcattgactgaataccttcaaaatgtggagcaaaagaagagacagctg
gaggaatctgttgattccctcagtgaagaactagtccagcttcgagcacaagagaaggtc
catgaaatggaaaaggagcacttaaataaggttcagactgcaaatgaagttaagcaagcc
gttgaacagcagatccaaagccacagagaaactcatcaaaaacaaatcagtagtttgaga
gatgaaattgaggcgaaagaaaaacttattactgatcttcaagaccaaactcagaaaatg
atgttagagcaggaacgtctgaaagtagaacatgagaagttgaaaactacagatcaggaa
aagagcagaaaattacatgaacttacggttatgcaagatagacgagaacaagcaagacaa
gacttgaagggtttggaggagacagtggcaaaagaacttcagactttacacaacctgcgg
aagctctttgttcaggacctggccaccagagttaaaaagagtgccgaaattgattctgat
gacactggaggcagtgctgctcaaaagcaaaaaatctcctttcttgaaaataatcttgaa
caactcactaaagtgcacaaacagttggtacgtgataatgcagatcttcgctgtgaactt
cctaagttggaaaagcgacttagagctacagctgagagagtgaaagctttggagtcagca
ctaaaagaagccaaagaaaatgcatctcgtgatcgcaaacgctatcagcaagaagtagat
cgtataaaggaagcagtcaggtcaaaaaatatggccagaagaggacattctgcacaaatt
gctaaacctattcgtcctgggcaacatccagcagcttctccaactcatccaagtgcaatt
cgtggaggaggcgcatttgtccagaacagccagccagtgacagtacgaggtggaggaggc
aaacaagtgtaa

KEGG   Equus caballus (horse): 100146791
Entry
100146791         CDS       T01058                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb05200  Pathways in cancer
ecb05216  Thyroid cancer
ecb05223  Non-small cell lung cancer
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100146791 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100146791 (RET)
   05230 Central carbon metabolism in cancer
    100146791 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100146791 (RET)
   05223 Non-small cell lung cancer
    100146791 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100146791 (RET)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100146791 (RET)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100146791 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 100146791
NCBI-ProteinID: XP_023502504
VGNC: 51660
LinkDB
Position
1
AA seq 1113 aa
MAKATAGAAGLRLLLLLPLLGEAPLGLYFSRDAYWEKLYVDQPAGTPLLYVHALRDVPEE
VPTFRLGQHLYGAYRTRLHENDWIRIQEDTGLLYLNQSLDHSSWEQLSVRNGGFPLLTVY
LQVFLSPTSLREGECQWPGCARVYFSFINTSFPACGSLKPRELCFPETGLSFRVRENRPP
GTFHQFRLLPVQFLCPNVSVAYRLLGGESLPFRCARDSLEVSTRWALDRERREKYELVAV
CTVRIGAREEEVMVPFLVTVYDEDDSAPTFLGGVDTASAVVEFKRKEGTVVATLRVFDAD
VVPASGELLRRYTSTLLPGDAWALQTFRVEHLPNETLVQANGSFVRATVHDYRLVLNRSL
PISESRELQLAVLVNDSDFQGPGEGILLLHFNVSVLPVSLRLPSAYSFTVSRRARRFAQI
GKVCVENCQEFSGIHVQYKLQLPNANCSALGVVTSAEDTSGTLFVNDTEALRRPECTQLQ
YTVVAADRPTRRQAQAPVLVTVEGTYMAEEPGCPLSCAVSKRRPECEECGGLGSLTGRCE
WRQGDGKGITRNFSTCSPSIRTCPDGHCDAVESRDANVCPQDCLRGGSIIGGHEPGERRG
IKAGFGICNCFPEEKKCFCEPEDSQALLCDELCRTVIAAAVLFSFIVSVLLSTFCIHRYH
KNAHKPPIASAEMTFRRPTQAFPVSYSSAGARRPSLDSMENQVSVDAFKIPEDPKWEFPR
KNLVLGKTLGEGEFGKVVEATAFRLKGKAGYTTVAVKMLKENASPSELRDLLSEFNLLKQ
VNHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGYVGSGGSRNSSYLDNP
DERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYE
EDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLF
NLLKTGYRMERPDNCSEEMYGLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAAS
TPSDSLLYDDGLSEEETPLVDCNNTPLPRTLPSTWIENKLYGMSDPNWPEESPVPLTRAD
GTNTGCPRYANDSVYANWMVSPSAAQLMDAFDS
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacggccggcgccgcggggctgcggttgctgctgctgctgccgctgctc
ggcgaagcccctctgggactctacttctcaagggatgcttactgggagaagctgtatgtg
gaccagccggccggcacacccctgctctatgtccacgccctgcgtgatgtccctgaggag
gtgcccaccttccgcctgggacaacacctctatggtgcctaccgtacgcggctgcacgag
aatgactggatccgcatccaggaggacacgggtcttctttaccttaaccagagcctggac
cacagctcctgggagcagctcagcgtccgcaatgggggcttccccctgctcaccgtctac
ctccaggtctttctgtcgcccacgtccctgcgtgagggcgagtgccagtggccaggctgt
gcccgtgtgtacttctccttcatcaacacctccttcccagcttgtggctccctcaaaccc
cgggagctctgcttccccgagacaggcctctccttccgcgttcgggagaacaggcctcct
ggcaccttccaccagttccgcctgctgcccgtgcagttcctctgccccaacgtcagcgtg
gcctacaggctcctgggaggggagagtctgccattccgctgtgcccgggacagcctggaa
gtgagcacgcgctgggccctggaccgcgagcggcgggagaagtatgagctggtggccgta
tgcacggtgcgcatcggtgcgcgcgaggaggaggtgatggtgcccttcctcgtgactgtg
tacgatgaggacgactcagcgcccaccttcctcgggggcgttgatactgccagcgccgtg
gtggagttcaagcggaaggagggcactgtggtggccacactacgtgtcttcgatgcggat
gtagtgccggcgtctggggagctcctgaggcggtacacaagcacgctgctccctggggac
gcctgggccctccagaccttccgtgtagagcacttgcccaatgagactttggtccaggcc
aacggcagctttgtgcgggccaccgtgcatgactacaggctggttctgaataggagcctc
cccatctcggagagccgcgagctgcagctggccgtgctagtcaacgactcggacttccag
ggccctggtgagggcatcctcctcctccacttcaacgtgtctgtgctgcccgtcagcctg
cgcttgcccagcgcttactccttcaccgtgagcaggcgggcccgccgctttgcccagatt
gggaaagtctgtgtggagaactgccaggaattcagtggcatccatgtgcagtataagctg
cagcttcccaacgccaactgcagtgccctgggggtggtcacctcggctgaggacacctca
gggaccctgttcgtgaatgacacggaggccctgcggcggcccgagtgtacccagctccag
tacacagtggtggccgctgaccggccgacccgcaggcaggcccaggccccagtgctcgtc
accgtggaggggacgtacatggctgaggagccaggctgccccctgtcctgtgcagtcagc
aagaggcggcccgagtgtgaggagtgtggtggcctgggctctctgaccggcaggtgcgag
tggagacagggagatggcaaagggatcaccaggaacttctccacctgctcccccagcatc
aggacctgccccgatggccactgtgacgctgtggagagcagagatgccaatgtctgcccc
caggactgcctccggggcggcagcatcattggtgggcatgagccaggggagcgccggggg
attaaagccggcttcggcatctgcaactgcttccctgaggagaagaagtgcttctgtgag
ccggaagacagccaggctctgctgtgtgacgagctgtgccgcacagtgatcgcggcggcc
gtgctcttctccttcatcgtctccgtgctgctctccaccttctgcatccaccgctaccac
aagaatgcccacaagccgcccatcgcctcagccgagatgaccttccgccggcccacccag
gccttcccggtcagctactcctcggccggtgcccgccggccctcgctggactccatggag
aaccaggtctctgtggacgccttcaagatcccggaggatccaaagtgggaattccctcgg
aagaacttggttcttggaaaaactctgggagaaggcgaatttggaaaagtggtcgaggca
acggccttcaggctaaaaggcaaagctgggtacacgaccgtggctgtgaagatgctgaaa
gagaacgcctccccaagcgagctgcgggacctcctgtcagagttcaacctcctgaagcag
gtcaaccacccacaggtcatcaagctgtacggggcctgcagccaggatgggccactcctc
ctcatcgtggagtatgccaagtatggctccctgcggggcttcctccgggagagccgcaag
gcagggcctggctacgtgggcagtggaggcagccgcaactccagctacctggacaacccc
gacgagcgggccctgaccatgggcgacctcatctccttcgcctggcagatctctcggggg
atgcagtacctggctgagatgaagcttgtccatcgggacttggcagccagaaatgtccta
gtagctgaggggcggaagatgaagatttcggattttggcctgtcccgagacgtttatgag
gaggattcctacgtgaagaggagcaagggtcggattccagtcaaatggatggcaattgag
tccctttttgatcatatctacaccacccaaagtgatgtatggtcctttggtgtcctgctg
tgggagattgtgaccctggggggcaacccctatcctgggattcctcctgagcggctcttc
aaccttctgaagacaggctaccggatggagaggccagacaactgcagcgaggagatgtac
ggtctgatgctgcagtgctggaagcaggagccagacaagagaccagtgtttgctgacatc
agcaaagacctggagaagatgatggttaagagcagagactacttagacctggctgcgtcc
accccatctgactccctgctctacgacgatggcctctcggaggaggagacacccctggtg
gactgtaataatactcccctccctcgaaccctcccctccacgtggattgaaaacaaactc
tatggcatgtcagacccgaactggcctgaagagagtcctgtaccactcacgagagccgat
ggcactaacactgggtgtccgagatatgcaaatgatagtgtatatgctaactggatggtt
tcaccctcagcggcacagttaatggacgcgtttgatagttaa

DBGET integrated database retrieval system