KEGG   Equus caballus (horse): 100050617Help
Entry
100050617         CDS       T01058                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7 isoform X4
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05034  Alcoholism
ecb05165  Human papillomavirus infection
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100050617 (HDAC7)
  09165 Substance dependence
   05034 Alcoholism
    100050617 (HDAC7)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    100050617 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100050617 (HDAC7)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100050617 (HDAC7)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100050617 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100050617
NCBI-ProteinID: XP_005611168
Ensembl: ENSECAG00000020424
VGNC: 50596
LinkDB All DBs
Position
6
AA seq 968 aa AA seqDB search
MGCPRPRADTPGPQPQPMDLRVGQRPTVEPPPEPTLLALQHPPRLHHHLFLTGLQPQRSA
EPMRLSMDAPMPELQVGQQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALER
TVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRY
KPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPGPGL
GTEALLGQRLRLQETSVAPFALPTVSLLPAITLGLPAPARADGDHRTHLTLGPRGPVLGS
PHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSAPHAPLLTVPGLGPLPFHFAQSFLTTER
LSGSGLHRPLSRTRSEPLPPSATAPPPLGPLQPRLERLKPHIQLTKRPAKSEKPRLRQIP
SAEDLETDGGGVGPVGDDGLEHRESSHGHHEARGPVPLQQHQQVFLWDHQRLAGRLPRGS
TGDSVLLPLAQGSHRPLSRAQSSPAAPASLPTPEPASQARVLPSSETPARTLPFTTGLVY
DSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSER
HVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGS
VTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKILIV
DWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGG
LDPPMGDPEYLAAFRIVVMPVAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMT
QQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSL
EAVIRVHSKYWGCMQRLASCPDSWVPRLPGADAEEVEAVTALASLSVGILAEERPSEQLV
EEEEPMNL
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgggctgccccaggccccgtgcagacacgccaggccctcagccccagcccatggacctg
cgggtgggccagcggcccacggtggagcccccaccggagcccacgctgctggccctgcag
caccccccgcgtctgcaccaccacctcttcctgacaggcctgcagccgcagcgctcggcg
gagcccatgaggctctcaatggatgcgccgatgcccgagttgcaggtggggcagcaggag
caggagctgcggcagcttctccataaggacaagagcaagcgaagtgccgtggccagcagt
gtggtcaagcagaagctggcggaggtgattttgaagaaacagcaggcagccttagagaga
acagtccatcccaatagccccagcatcccctacagaactcttgagcccttggagacggaa
ggtgccgcccgctccatgctcagcagctttctgcctcccgttcccagcctgcccagtgac
cccccagaacacttccctctgcgtaagacagtctcggagcccaacctgaagctgcgctac
aagcccaagaagtcactggagcggaggaagaatccgctgctcagaaaggagagcgccccg
cccagtctccggcgccggcctgcagagaccctcggtgactcctccccgagtagcagcagc
acgccagcctcggggtgcagctcccccaatgacagcgagcatggccccggccccggcctg
ggcacagaggcgctcttgggccagcggctgcggctgcaggagacctctgtggccccgttc
gccttgccgacagtgtccttgctgcccgcaatcacgctggggctgcccgcccctgccagg
gcggatggtgaccacaggacccatctaactctgggccctcgggggccagtcctggggagc
ccccatgctcccctcttcctgccccatggcctggagcctgaggctgggggccccttgccc
tctcgcctgcagcccattctcctcctggatccctcagcccctcacgcacccctgctgact
gtgcccgggcttgggcccctgcccttccactttgcccagtccttcctgaccaccgaacgg
ctctccgggtcaggcctccacaggccgctgagccggacccgctcagagcccctgccccca
agcgccaccgcccccccaccgctgggccccctgcagccccgcctggagcgactcaaacct
cacatccagctgaccaagaggccagccaagagtgagaagccccgactgcggcagattccc
tcggctgaggacctagagacggatggtgggggagtggggccggtgggggatgacggcctg
gaacacagggagtcgagccatgggcaccatgaggccaggggccctgttcctctccagcag
caccaacaggtgttcctctgggaccatcagcgactggctgggcggctcccccggggcagc
actggggactctgtgctgcttcccctggcccagggcagtcaccggcccctgtccagggct
cagtcgtccccagctgcgcctgcctcactgccaaccccagagcctgccagccaggcccgc
gtcctgcccagctcagagacccccgccaggaccctgcccttcaccacagggctggtctat
gactccgtaatgctgaagcaccagtgttcctgcggagacaacagcaggcacccagagcat
gctggccgcatccagagcatctggtcccggctgcaggagcgggggctgcggagccagtgt
gagtgtctccggggccggaaggcctccctggaggagctgcagtctgtgcattccgagcgg
cacgtgctcctctatggcaccaacccgctcagccgcctcaaactggacaacgggaagctg
gcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggggttggggtggat
actgacaccatctggaatgagctgcactcctccaatgcagcccgttgggccgccggcagc
gtcactgaccttgccttcaaagtggcttcccgcgaactaaagaacggttttgctgtggtt
cggcctccaggacaccatgcagaccattccactgccatgggcttctgcttcttcaactca
gtggccatcgcctgccgacagctgcaacaacagggcaaggccagcaagatcctcattgtg
gactgggatgttcaccacggcaacggcacccagcaaaccttctaccaggaccccagcgtg
ctctacatctccctgcatcgccatgacgacggcaacttcttcccaggcagtggggctgtg
gatgaggtgggagctggcagcggtgagggcttcaatgtcaacgtggcctgggccggaggt
ctggaccccccaatgggggatcctgagtacctggccgccttcaggatcgtcgtgatgcct
gttgcccgagagttctctccagacctggtcctggtgtcagctgggtttgatgctgccgag
ggtcaccccgccccgctgggtggctaccatgtttccgccaaatgttttgggtacatgacg
cagcagctgatgagcttggcaggaggtgccgtggtgctggccttggagggcggccatgac
ctcaccgccatctgtgacgcctccgaggcctgtgtggctgctcttctgggcaacaaggtg
gatcccctctcagaagaaggctggaaacagaaacccaacctcaacgccatccgttctctg
gaagctgtgatccgggtgcacagtaaatactggggctgcatgcagcgcctggcctcctgt
cccgactcctgggtgcccaggctgccaggagccgatgcagaagaagtggaggcagtgacc
gcactggcatccctctctgtgggcatcctggctgaagagaggccctcagagcagctggtg
gaggaggaagaacctatgaatctctaa

DBGET integrated database retrieval system