KEGG   Equus caballus (horse): 100050675
Entry
100050675         CDS       T01058                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04024  cAMP signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04724  Glutamatergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04962  Vasopressin-regulated water reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100050675
   04020 Calcium signaling pathway
    100050675
   04072 Phospholipase D signaling pathway
    100050675
   04024 cAMP signaling pathway
    100050675
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100050675
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100050675
  09152 Endocrine system
   04911 Insulin secretion
    100050675
   04922 Glucagon signaling pathway
    100050675
   04923 Regulation of lipolysis in adipocytes
    100050675
   04912 GnRH signaling pathway
    100050675
   04913 Ovarian steroidogenesis
    100050675
   04915 Estrogen signaling pathway
    100050675
   04921 Oxytocin signaling pathway
    100050675
   04926 Relaxin signaling pathway
    100050675
   04935 Growth hormone synthesis, secretion and action
    100050675
   04918 Thyroid hormone synthesis
    100050675
   04928 Parathyroid hormone synthesis, secretion and action
    100050675
   04916 Melanogenesis
    100050675
   04924 Renin secretion
    100050675
   04925 Aldosterone synthesis and secretion
    100050675
   04927 Cortisol synthesis and secretion
    100050675
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100050675
   04270 Vascular smooth muscle contraction
    100050675
  09154 Digestive system
   04970 Salivary secretion
    100050675
   04971 Gastric acid secretion
    100050675
   04972 Pancreatic secretion
    100050675
   04976 Bile secretion
    100050675
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100050675
   04961 Endocrine and other factor-regulated calcium reabsorption
    100050675
  09156 Nervous system
   04724 Glutamatergic synapse
    100050675
   04728 Dopaminergic synapse
    100050675
   04726 Serotonergic synapse
    100050675
   04730 Long-term depression
    100050675
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100050675
  09159 Environmental adaptation
   04713 Circadian entrainment
    100050675
   04714 Thermogenesis
    100050675
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050675
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100050675
  09165 Substance dependence
   05030 Cocaine addiction
    100050675
   05031 Amphetamine addiction
    100050675
   05032 Morphine addiction
    100050675
   05034 Alcoholism
    100050675
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100050675
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100050675
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100050675
   05165 Human papillomavirus infection
    100050675
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100050675
   05142 Chagas disease
    100050675
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100050675
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100050675
  Exosomal proteins of other body fluids (saliva and urine)
   100050675
  Exosomal proteins of colorectal cancer cells
   100050675
  Exosomal proteins of bladder cancer cells
   100050675
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100050675
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 100050675
NCBI-ProteinID: XP_023482585
Ensembl: ENSECAG00000004696
LinkDB
Position
22
AA seq 250 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQAFPEPPESDQEHEEADLELSLPECLEYEEEFDYESETETESEIESE
TDFETEPETAPATEPETEPEDERGPVVPKRPTFGERGSLTQRLQALRLRSPDASPSRAQP
STQEPQSPREGEEPEPEDKDPRDPEESEEPKEKEKKEKQQQRRCKPKKPTRRDPSPESPS
KRGPIPIRRH
NT seq 753 nt   +upstreamnt  +downstreamnt
atggatcgtaggtcccgggctcagcagtggcgccgagctcgccacaattacaacgatctg
tgcccacccataggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgcgcccagcagcgcgcggctgcccagcag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggcgttccccgagcccccg
gaatctgaccaggagcacgaggaggcagacctcgagctatccctccccgagtgcctagag
tacgaggaagagttcgactacgaatctgagaccgagaccgagtctgaaatcgagtccgag
accgacttcgagaccgagcccgaaaccgcccctgccactgagcccgagaccgagcccgag
gacgagcgcggtcctgtggtgcccaagcgccccactttcggcgaaaggggctctctcacc
cagcgcctgcaggctctgaggctgcggagccccgacgcctccccaagtcgtgcgcagccc
agcactcaggagccccagagccccagagagggggaggagcccgagcccgaggacaaggat
ccgagggaccccgaagagtccgaggagccaaaggagaaggagaagaaggagaagcagcag
cagcgccgctgcaagccgaagaagcccacccgccgcgacccatccccggagtctccttcc
aaaaggggacccatccccatccggcgtcactaa

KEGG   Equus caballus (horse): 100056464
Entry
100056464         CDS       T01058                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04024  cAMP signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04724  Glutamatergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04962  Vasopressin-regulated water reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100056464
   04020 Calcium signaling pathway
    100056464
   04072 Phospholipase D signaling pathway
    100056464
   04024 cAMP signaling pathway
    100056464
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100056464
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100056464
  09152 Endocrine system
   04911 Insulin secretion
    100056464
   04922 Glucagon signaling pathway
    100056464
   04923 Regulation of lipolysis in adipocytes
    100056464
   04912 GnRH signaling pathway
    100056464
   04913 Ovarian steroidogenesis
    100056464
   04915 Estrogen signaling pathway
    100056464
   04921 Oxytocin signaling pathway
    100056464
   04926 Relaxin signaling pathway
    100056464
   04935 Growth hormone synthesis, secretion and action
    100056464
   04918 Thyroid hormone synthesis
    100056464
   04928 Parathyroid hormone synthesis, secretion and action
    100056464
   04916 Melanogenesis
    100056464
   04924 Renin secretion
    100056464
   04925 Aldosterone synthesis and secretion
    100056464
   04927 Cortisol synthesis and secretion
    100056464
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100056464
   04270 Vascular smooth muscle contraction
    100056464
  09154 Digestive system
   04970 Salivary secretion
    100056464
   04971 Gastric acid secretion
    100056464
   04972 Pancreatic secretion
    100056464
   04976 Bile secretion
    100056464
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100056464
   04961 Endocrine and other factor-regulated calcium reabsorption
    100056464
  09156 Nervous system
   04724 Glutamatergic synapse
    100056464
   04728 Dopaminergic synapse
    100056464
   04726 Serotonergic synapse
    100056464
   04730 Long-term depression
    100056464
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100056464
  09159 Environmental adaptation
   04713 Circadian entrainment
    100056464
   04714 Thermogenesis
    100056464
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056464
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100056464
  09165 Substance dependence
   05030 Cocaine addiction
    100056464
   05031 Amphetamine addiction
    100056464
   05032 Morphine addiction
    100056464
   05034 Alcoholism
    100056464
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100056464
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100056464
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100056464
   05165 Human papillomavirus infection
    100056464
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100056464
   05142 Chagas disease
    100056464
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100056464
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100056464
  Exosomal proteins of other body fluids (saliva and urine)
   100056464
  Exosomal proteins of colorectal cancer cells
   100056464
  Exosomal proteins of bladder cancer cells
   100056464
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100056464
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA GTP_EFTU AAA_29 TniB
Other DBs
NCBI-GeneID: 100056464
NCBI-ProteinID: XP_023482586
Ensembl: ENSECAG00000024243
LinkDB
Position
22
AA seq 395 aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFN
DVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAE
KVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggctgcctcggaaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgc
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccattgtgaagcaaatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtagtgagaaggcaaccaaggtgcaggacatcaaaaacaacctg
aaagaggccattgaaaccatcgtggccgccatgagcaacctggtgccccctgtggagctg
gccaaccctgagaaccagttcagagtggactacatcctgagcgtgatgaacgtgcccgac
ttcgacttccctcctgaattctacgagcacgccaaggctctgtgggaggatgaaggagtg
cgtgcctgctatgagcgctccaacgagtaccagctgattgactgcgcccagtacttcctg
gacaagattgatgtcatcaagcaggctgactatgtgcccagcgaccaggatctgctccgc
tgccgcgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttc
cacatgtttgacgtgggtggccagcgcgatgaacgccgcaaatggatccaatgcttcaat
gatgtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcatccgggag
gacaaccagaccaaccgcctgcaggaggccctgaacctcttcaagagcatctggaataac
agatggctgcgcaccatctctgtgattctgttcctcaacaagcaagacctgctcgctgag
aaagtccttgctggaaaatcgaaaattgaggactactttccagaatttgctcgctacact
actcctgaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaagtac
ttcatccgtgacgaatttctgagaatcagcaccgctagtggggacgggcgccactactgc
tacccccacttcacctgcgctgtggacaccgagaacatccgccgggtgttcaacgactgc
cgggacatcatccagcgcatgcacctccgtcagtatgagctgctctaa

DBGET integrated database retrieval system