KEGG   Equus caballus (horse): 100050934
Entry
100050934         CDS       T01058                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X1
  KO
K02161  apoptosis regulator Bcl-2
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04115  p53 signaling pathway
ecb04140  Autophagy - animal
ecb04141  Protein processing in endoplasmic reticulum
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04217  Necroptosis
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04340  Hedgehog signaling pathway
ecb04510  Focal adhesion
ecb04621  NOD-like receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04915  Estrogen signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05014  Amyotrophic lateral sclerosis
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05162  Measles
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05215  Prostate cancer
ecb05222  Small cell lung cancer
ecb05226  Gastric cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100050934 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100050934 (BCL2)
   04630 JAK-STAT signaling pathway
    100050934 (BCL2)
   04064 NF-kappa B signaling pathway
    100050934 (BCL2)
   04066 HIF-1 signaling pathway
    100050934 (BCL2)
   04071 Sphingolipid signaling pathway
    100050934 (BCL2)
   04151 PI3K-Akt signaling pathway
    100050934 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100050934 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100050934 (BCL2)
   04215 Apoptosis - multiple species
    100050934 (BCL2)
   04217 Necroptosis
    100050934 (BCL2)
   04115 p53 signaling pathway
    100050934 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100050934 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100050934 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100050934 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100050934 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100050934 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100050934 (BCL2)
   04722 Neurotrophin signaling pathway
    100050934 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050934 (BCL2)
   05206 MicroRNAs in cancer
    100050934 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100050934 (BCL2)
   05226 Gastric cancer
    100050934 (BCL2)
   05215 Prostate cancer
    100050934 (BCL2)
   05222 Small cell lung cancer
    100050934 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100050934 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100050934 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100050934 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100050934 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100050934 (BCL2)
   05152 Tuberculosis
    100050934 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100050934 (BCL2)
   05161 Hepatitis B
    100050934 (BCL2)
   05162 Measles
    100050934 (BCL2)
   05168 Herpes simplex virus 1 infection
    100050934 (BCL2)
   05169 Epstein-Barr virus infection
    100050934 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100050934 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100050934 (BCL2)
   01524 Platinum drug resistance
    100050934 (BCL2)
   01522 Endocrine resistance
    100050934 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100050934 (BCL2)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100050934 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100050934
NCBI-ProteinID: XP_001490486
Ensembl: ENSECAG00000020437
VGNC: 15790
UniProt: F7CDX6
LinkDB
Position
8
AA seq 232 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFSSQPGRTPAPA
RTSPLLPPAAPAGAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTAR
GRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHT
WIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccgcgcccctg
ggggccacccccgtgccgggcatcttctcctcccagcccgggcgcacccccgcgcccgcc
aggacctccccgctgctacccccggccgcccccgccggcgccgcgggacctgccctcagc
cctgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttctcccgtcgc
taccgccgcgactttgccgagatgtccagccagctgcacctgacgcctttcaccgcaagg
ggacgctttgccacggtagtggaggagctcttcagggatggggtgaactgggggaggatt
gtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcg
cccctggtggacaacatcgccctgtggatgactgaatacctgaaccggcacctgcacacc
tggatccaggataacggaggctgggacgcctttgtggaactgtacggccccagcatgcgg
ccgctgtttgatttctcctggctgtctctgaaggcgctgctcagtctggccctggtggga
gcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system