KEGG   Equus caballus (horse): 100051000
Entry
100051000         CDS       T01058                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X2
  KO
K08015  Ras association domain-containing protein 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04218  Cellular senescence
ecb04670  Leukocyte transendothelial migration
ecb05200  Pathways in cancer
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100051000 (RASSF5)
   04015 Rap1 signaling pathway
    100051000 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100051000 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100051000 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051000 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100051000 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA
Other DBs
NCBI-GeneID: 100051000
NCBI-ProteinID: XP_001491777
Ensembl: ENSECAG00000019451
VGNC: 22212
LinkDB
Position
5
AA seq 265 aa
MTVDSSMSSGYCSLEEELEDCFFTAKTTFFRSVQSKRPSKNVCKPAEETRPPPTLQEIKQ
KIQSYNSREKECLRMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAAT
TAKRTSFYLPLDAIKQLHISSATTVSEVIQGLLKKFMVVDNPQKFALFKQINKDGQVLFQ
KLSVADCPLYLRLLAGPDTDVLSFVLKENETGEVEWDDFSIPELQNFLTILEKEERDKIQ
QVQKKYDKFRQKLAEALRESQGKPG
NT seq 798 nt   +upstreamnt  +downstreamnt
atgacggtggacagcagcatgagcagtgggtactgcagcctggaggaggagctggaagat
tgcttcttcaccgctaagaccacctttttcaggagtgtgcagagcaaacgtccttcgaag
aatgtctgtaaacccgccgaggagacgcggcccccgcccacactgcaggagatcaagcag
aagatccagagctacaacagccgggagaaagagtgcctgcgcatgaagctgagcgaagac
ggcacctacacgggtttcatcaaagtgcatttgaaacttcggcggccggtgacggtgcct
gctgggatccggccccagtccatctatgacgccattaaggaagtgaacctggcggccacc
acggctaagaggacctccttctacctgccgctcgatgccatcaagcagctgcacatcagc
agcgccaccacggtcagcgaggtcattcaggggctgctcaagaagttcatggtcgtggac
aacccccagaagtttgcactgtttaagcagataaacaaggacgggcaagtgctcttccag
aaactctccgtggcggactgccccctctacctgcgcctgcttgctgggcctgacactgat
gtgctcagctttgtgctgaaggagaatgaaactggagaggtggagtgggatgacttctcc
atccctgagctccagaacttcctaacaatcctggaaaaggaggagcgggacaaaatccag
caagtgcagaagaagtatgacaagtttaggcagaaactggcggaggccttaagagaatct
cagggcaaacctggctaa

DBGET integrated database retrieval system