KEGG   Equus caballus (horse): 100051005
Entry
100051005         CDS       T01058                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X2
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04530  Tight junction
ecb04660  T cell receptor signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb05160  Hepatitis C
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05212  Pancreatic cancer
ecb05214  Glioma
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100051005 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100051005 (CDK4)
   04115 p53 signaling pathway
    100051005 (CDK4)
   04218 Cellular senescence
    100051005 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100051005 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100051005 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051005 (CDK4)
   05203 Viral carcinogenesis
    100051005 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100051005 (CDK4)
   05225 Hepatocellular carcinoma
    100051005 (CDK4)
   05214 Glioma
    100051005 (CDK4)
   05220 Chronic myeloid leukemia
    100051005 (CDK4)
   05218 Melanoma
    100051005 (CDK4)
   05219 Bladder cancer
    100051005 (CDK4)
   05224 Breast cancer
    100051005 (CDK4)
   05222 Small cell lung cancer
    100051005 (CDK4)
   05223 Non-small cell lung cancer
    100051005 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051005 (CDK4)
   04934 Cushing syndrome
    100051005 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051005 (CDK4)
   05160 Hepatitis C
    100051005 (CDK4)
   05164 Influenza A
    100051005 (CDK4)
   05162 Measles
    100051005 (CDK4)
   05163 Human cytomegalovirus infection
    100051005 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051005 (CDK4)
   05169 Epstein-Barr virus infection
    100051005 (CDK4)
   05165 Human papillomavirus infection
    100051005 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100051005 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100051005 (CDK4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100051005 (CDK4)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100051005 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 100051005
NCBI-ProteinID: XP_005611409
Ensembl: ENSECAG00000025015
VGNC: 16348
UniProt: F6QM47
LinkDB
Position
6
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKPEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccctcggtatgagccagtggctgagattggtgtcggcgcctatgggacggtg
tacaaggcccgtgatccccacagtggccactttgtggcccttaagagcgtgagagtcccc
aatggaggaggcgctggagggggccttcccatcagcacagttcgtgaggtggccttgctg
aggcggctggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccact
gcccgaactgaccgggagaccaaagtgaccctggtatttgagcatgtggaccaagaccta
aggacgtatctcgacaaggcacccccgcccggcttgccagtggagaccatcaaggatctg
atgcgccagttcctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcaatctacgtatgcaacacctgtggacatgtggagtgtg
ggctgtattttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctacccccagaggaagactggccgcga
gatgtgtctctaccccgaggagcctttccccccagagggccccgccccgtgcagtcggtg
gtgcccgagatggaggagtctggagcacagctgcttctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaagccggaaggt
aacccagagtga

DBGET integrated database retrieval system