KEGG   Equus caballus (horse): 100051110
Entry
100051110         CDS       T01058                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb04270  Vascular smooth muscle contraction
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04613  Neutrophil extracellular trap formation
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04935  Growth hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05132  Salmonella infection
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100051110 (RAF1)
   04012 ErbB signaling pathway
    100051110 (RAF1)
   04014 Ras signaling pathway
    100051110 (RAF1)
   04015 Rap1 signaling pathway
    100051110 (RAF1)
   04370 VEGF signaling pathway
    100051110 (RAF1)
   04371 Apelin signaling pathway
    100051110 (RAF1)
   04630 JAK-STAT signaling pathway
    100051110 (RAF1)
   04068 FoxO signaling pathway
    100051110 (RAF1)
   04072 Phospholipase D signaling pathway
    100051110 (RAF1)
   04071 Sphingolipid signaling pathway
    100051110 (RAF1)
   04024 cAMP signaling pathway
    100051110 (RAF1)
   04022 cGMP-PKG signaling pathway
    100051110 (RAF1)
   04151 PI3K-Akt signaling pathway
    100051110 (RAF1)
   04150 mTOR signaling pathway
    100051110 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100051110 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100051110 (RAF1)
   04218 Cellular senescence
    100051110 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100051110 (RAF1)
   04540 Gap junction
    100051110 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100051110 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100051110 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100051110 (RAF1)
   04625 C-type lectin receptor signaling pathway
    100051110 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100051110 (RAF1)
   04660 T cell receptor signaling pathway
    100051110 (RAF1)
   04662 B cell receptor signaling pathway
    100051110 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100051110 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100051110 (RAF1)
   04062 Chemokine signaling pathway
    100051110 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100051110 (RAF1)
   04929 GnRH secretion
    100051110 (RAF1)
   04912 GnRH signaling pathway
    100051110 (RAF1)
   04915 Estrogen signaling pathway
    100051110 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100051110 (RAF1)
   04917 Prolactin signaling pathway
    100051110 (RAF1)
   04921 Oxytocin signaling pathway
    100051110 (RAF1)
   04926 Relaxin signaling pathway
    100051110 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100051110 (RAF1)
   04919 Thyroid hormone signaling pathway
    100051110 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100051110 (RAF1)
   04916 Melanogenesis
    100051110 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100051110 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100051110 (RAF1)
   04720 Long-term potentiation
    100051110 (RAF1)
   04730 Long-term depression
    100051110 (RAF1)
   04722 Neurotrophin signaling pathway
    100051110 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100051110 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051110 (RAF1)
   05206 MicroRNAs in cancer
    100051110 (RAF1)
   05205 Proteoglycans in cancer
    100051110 (RAF1)
   05230 Central carbon metabolism in cancer
    100051110 (RAF1)
   05231 Choline metabolism in cancer
    100051110 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100051110 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051110 (RAF1)
   05212 Pancreatic cancer
    100051110 (RAF1)
   05225 Hepatocellular carcinoma
    100051110 (RAF1)
   05226 Gastric cancer
    100051110 (RAF1)
   05214 Glioma
    100051110 (RAF1)
   05221 Acute myeloid leukemia
    100051110 (RAF1)
   05220 Chronic myeloid leukemia
    100051110 (RAF1)
   05218 Melanoma
    100051110 (RAF1)
   05211 Renal cell carcinoma
    100051110 (RAF1)
   05219 Bladder cancer
    100051110 (RAF1)
   05215 Prostate cancer
    100051110 (RAF1)
   05213 Endometrial cancer
    100051110 (RAF1)
   05224 Breast cancer
    100051110 (RAF1)
   05223 Non-small cell lung cancer
    100051110 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100051110 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100051110 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100051110 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100051110 (RAF1)
   05152 Tuberculosis
    100051110 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100051110 (RAF1)
   05161 Hepatitis B
    100051110 (RAF1)
   05160 Hepatitis C
    100051110 (RAF1)
   05164 Influenza A
    100051110 (RAF1)
   05163 Human cytomegalovirus infection
    100051110 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051110 (RAF1)
   05165 Human papillomavirus infection
    100051110 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100051110 (RAF1)
   01522 Endocrine resistance
    100051110 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100051110 (RAF1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100051110 (RAF1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100051110 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100051110
NCBI-ProteinID: XP_001492290
Ensembl: ENSECAG00000011807
UniProt: F6QHE2
LinkDB
Position
16
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgcg
gtgtttgatggccccagctgtatctcccctacaatagttcagcagtttggctatcagcgt
cgggcgtcagatgatggcaaacttacggactcttctaagacaagcaacactatccgtgtt
ttcttgccaaataagcaaagaaccgtggtcaatgtgcgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcaaccggagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctca
ttgattggagaagagcttcaagtagatttcctggatcatgttcctctcacaacacacaac
tttgctcggaagacctttctgaagcttgccttttgtgacatctgtcagaagttcttgcta
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgcgtggactggagtaatatcagacaactcttattgtttccgaattccact
attggtgatagtggagtcccagcactgccttccttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacgccccacgccttcacattc
aacacctccagtccctcctctgaaggttccctctcccagaggcagagatcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagccacagtgaatcagcttcaccttcagccttgtccagcagccccaacaatctg
agcccaacgggctggtcacagcctaaaacccctgtgccggcacagagagagcgggcacca
ggatccgggacccaggagaaaaacaaaattagacctcgaggtcagagagattcaagctat
tactgggaaatagaagcgagtgaagtgatgctctccacccggattgggtcaggctccttt
ggaactgtgtataagggcaaatggcacggagacgttgcagtgaaaatcttaaaggttgtt
gaccccacaccagagcagttccaggcgttcaggaacgaggtggctgtcctgcgtaaaaca
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcaattgtg
actcagtggtgtgagggcagcagcctctacaaacacctgcatgtccaggagaccaagttc
cagatgttccagttgattgacatcgcccggcagacggctcagggaatggactatttgcat
gcaaaaaacatcatccacagagatatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagactttggtttggcaacagtcaagtcgcgctggagtggttctcag
caggttgaacaacccactggctctgtcctgtggatggccccagaggtgatccgaatgcag
gataataacccgttcagcttccagtctgatgtctactcctatggcattgtactctatgag
ctcatgacaggggaactgccttactcccacatcaacaaccgagatcagatcatcttcatg
gtgggccgagggtatgcctccccagaccttagtaagctatacaagaactgccccaaagca
atgaagaggcttgtggctgactgcgtgaagaaagttaaggaggagaggcctctttttccc
cagatcttgtcttccatcgagttgctccaacactctctaccgaaaatcaaccggagtgct
tctgagccatccctgcatcgggcggcccacaccgaggacatcaatgcctgcacgttgacc
acgtcccctagactgcctgtcttctag

KEGG   Equus caballus (horse): 100061212
Entry
100061212         CDS       T01058                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X2
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04068  FoxO signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04650  Natural killer cell mediated cytotoxicity
ecb04720  Long-term potentiation
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100061212 (ARAF)
   04012 ErbB signaling pathway
    100061212 (ARAF)
   04068 FoxO signaling pathway
    100061212 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100061212 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100061212 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100061212 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    100061212 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100061212 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100061212 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100061212 (ARAF)
   04720 Long-term potentiation
    100061212 (ARAF)
   04730 Long-term depression
    100061212 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061212 (ARAF)
   05205 Proteoglycans in cancer
    100061212 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100061212 (ARAF)
   05212 Pancreatic cancer
    100061212 (ARAF)
   05225 Hepatocellular carcinoma
    100061212 (ARAF)
   05226 Gastric cancer
    100061212 (ARAF)
   05214 Glioma
    100061212 (ARAF)
   05221 Acute myeloid leukemia
    100061212 (ARAF)
   05220 Chronic myeloid leukemia
    100061212 (ARAF)
   05218 Melanoma
    100061212 (ARAF)
   05211 Renal cell carcinoma
    100061212 (ARAF)
   05219 Bladder cancer
    100061212 (ARAF)
   05215 Prostate cancer
    100061212 (ARAF)
   05213 Endometrial cancer
    100061212 (ARAF)
   05224 Breast cancer
    100061212 (ARAF)
   05223 Non-small cell lung cancer
    100061212 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100061212 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100061212 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    100061212 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100061212 (ARAF)
   05160 Hepatitis C
    100061212 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100061212 (ARAF)
   01522 Endocrine resistance
    100061212 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100061212 (ARAF)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100061212 (ARAF)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100061212 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 100061212
NCBI-ProteinID: XP_005614153
Ensembl: ENSECAG00000023903
VGNC: 15438
LinkDB
Position
X
AA seq 607 aa
MESPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSLSPASSCTQHRDPEHFPFPASANAPLQRIRSTSTPNVHMVSTTAPMDSSLIQSF
STDAAGGRSGGDGASRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKNLGYRDS
GYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLR
KTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDY
LHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIR
MQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCP
KAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLL
SAARLVP
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggagtcaccacggggcccccctgccaacggggccgagccatcccgggcagtggggacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgattctctagacaaggccctcaaggtgcgaggtctcaatcaggattgctgtgtg
gtctaccggctcatcaaggggcgaaagacagttactgcctgggacacggccattgccccc
ctggatggcgaggagctcatcgtggaggtcctcgaagacgtcccactgaccatgcacaat
tttgtacggaagacattcttcagcctggcattctgcgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcacgaggctccctcgaaccgccccctgaatgagccgcta
acccctcagggtcccagcctttcccctgccagctcctgcacccagcaccgggaccctgag
cacttccccttccctgcctcggccaacgcccccctccagcgcatccgttccacctccacc
cccaacgtccatatggtcagcaccacagctcccatggactccagcctcatccagagtttc
agcaccgatgccgctggaggtagaagtggtggtgatggagcctcccgggggagccccagc
ccggccagcgtgtcctcggggaggaagtccccacattccaagtccccatcggagcagcgg
gagcgaaagtccttggctgacgacaagaagaaagtgaagaatctggggtaccgggactca
ggctattactgggaggtgccacccagcgaggtgcagctgctgaagaggatcgggacaggc
tcatttggcaccgtgtttcgcgggcggtggcatggtgatgtggccgtgaaggtgctcaag
gtggcgcaacccacagctgagcaggcccaggccttcaagaacgagatgcaggtgctcagg
aagacgcgtcatgtcaacatcttgctgttcatgggcttcatgacccggccgggctttgcc
atcatcacacagtggtgcgagggctccagcctctaccaccacctgcacgtggcggacaca
cgcttcgacatggtccagctcatcgacgtggcccggcagaccgcccagggcatggactac
cttcatgccaagaacatcatccatcgagatctcaagtctaacaacatcttcctacatgag
gggctcacggtgaagatcggtgacttcggcctggccacagtgaagacgaggtggagcggg
gcccagcccttggagcagccctcgggctctgtgctatggatggcggccgaggtgatccgt
atgcaggacccaaacccctacagcttccagtcggatgtctacgcctatggggttgtgctc
tatgagctcatgaccggctcactgccttacagccacattggcagccgtgaccagattatc
tttatggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgcccc
aaggccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggagcggcccctc
ttcccccagatcctggccacgattgagctactgcagcggtcactccccaagatcgagcgg
agtgcgtccgaaccctccttgcaccgcacccaggctgacgagttgcctgcctgcctactc
agcgcagcccgccttgtgccttag

KEGG   Equus caballus (horse): 100065760
Entry
100065760         CDS       T01058                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04150  mTOR signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04510  Focal adhesion
ecb04650  Natural killer cell mediated cytotoxicity
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100065760 (BRAF)
   04012 ErbB signaling pathway
    100065760 (BRAF)
   04015 Rap1 signaling pathway
    100065760 (BRAF)
   04068 FoxO signaling pathway
    100065760 (BRAF)
   04024 cAMP signaling pathway
    100065760 (BRAF)
   04150 mTOR signaling pathway
    100065760 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100065760 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100065760 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100065760 (BRAF)
   04062 Chemokine signaling pathway
    100065760 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100065760 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100065760 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100065760 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100065760 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100065760 (BRAF)
   04720 Long-term potentiation
    100065760 (BRAF)
   04730 Long-term depression
    100065760 (BRAF)
   04722 Neurotrophin signaling pathway
    100065760 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100065760 (BRAF)
   05205 Proteoglycans in cancer
    100065760 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100065760 (BRAF)
   05212 Pancreatic cancer
    100065760 (BRAF)
   05225 Hepatocellular carcinoma
    100065760 (BRAF)
   05226 Gastric cancer
    100065760 (BRAF)
   05214 Glioma
    100065760 (BRAF)
   05216 Thyroid cancer
    100065760 (BRAF)
   05221 Acute myeloid leukemia
    100065760 (BRAF)
   05220 Chronic myeloid leukemia
    100065760 (BRAF)
   05218 Melanoma
    100065760 (BRAF)
   05211 Renal cell carcinoma
    100065760 (BRAF)
   05219 Bladder cancer
    100065760 (BRAF)
   05215 Prostate cancer
    100065760 (BRAF)
   05213 Endometrial cancer
    100065760 (BRAF)
   05224 Breast cancer
    100065760 (BRAF)
   05223 Non-small cell lung cancer
    100065760 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100065760 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100065760 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100065760 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100065760 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100065760 (BRAF)
   05160 Hepatitis C
    100065760 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100065760 (BRAF)
   01522 Endocrine resistance
    100065760 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100065760 (BRAF)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100065760 (BRAF)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100065760 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100065760
NCBI-ProteinID: XP_001496314
Ensembl: ENSECAG00000002746
VGNC: 15875
LinkDB
Position
4
AA seq 764 aa
MAALSGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEA
LLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSS
SSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKK
ALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFF
TLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVSQE
EASLAETALTSGSSPSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRS
SSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQ
RERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVK
MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHI
IETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD
QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
IHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcgcggagcagggccaggctctgttcaacggg
gacatggagccggaggccggcgccggcgccgcggcctcgtcggccgcggaccctgccatt
cccgaggaggtatggaatatcaaacaaatgattaaattgacacaggaacatatagaggcc
ctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaa
gaatacaccagcaagctagatgccctccaacaaagagaacaacagttattggaatccctg
gggaatggaactgatttttctgtttctagttctgcatcaacggacaccgttacatcttct
tcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccacagat
gtgtcacggagcaaccctaagtcaccacaaaaacctatcgttagagtcttcctgcccaac
aaacagaggacagtggtacctgcaaggtgtggcgttacagtccgggacagtctaaagaaa
gcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatgga
gagaagaaaccaattggctgggacactgatatttcctggctcactggagaggaattgcat
gtagaagtgttggagaatgttccacttacaacacacaactttgtacggaaaacttttttc
accttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaaca
tgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattat
gaccaacttgatttgctgtttgtctccaagttctttgaacaccacccagtatcacaggag
gaggcctccttagcagagactgcccttacatctggatcatccccttctgcacccccctcc
gattccattgggccccaaattctcaccagtccatctccttcaaaatccattccaattcca
cagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcc
tcatcagctccaaatgtacatataaacacaatagaacctgtcaatattgatgacttgatt
agagaccaagggtttcgtagtgatggaggatcaaccacaggtttatctgccaccccccct
gcctcattacctggctcactcactaatgtgaaggcattacagaaatctccaggacctcaa
cgggaaaggaaatcatcttcatcctcagaagacaggaatcgaatgaaaactcttggtaga
cgggattcaagtgacgattgggagattcctgatgggcagatcacagtgggacaaagaatt
ggatctgggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtagga
gtactcaggaaaactcgacatgtgaatatcctactcttcatgggctattcaacaaagcca
caactggctattgttacccagtggtgtgagggctccagcttatatcaccatctccacatc
attgagaccaaatttgagatgatcaaacttatagatattgctcggcaaactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatattttt
cttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatctcga
tggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaa
gtaatcagaatgcaagataaaaacccgtatagctttcaatcagatgtatatgcctttggg
attgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagggac
cagataatttttatggtgggaagaggatatctatctccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagacgag
agaccactcttcccccaaattctcgcctctattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagagccctccttgaatcgggctggcttccagacagaggatttt
agtctatatgcttgtgcttctccgaaaacacccatccaggcagggggatatggagaattt
gcagccttcaagtag

DBGET integrated database retrieval system