KEGG   Equus caballus (horse): 100051174Help
Entry
100051174         CDS       T01058                                 

Gene name
SIN3A
Definition
(RefSeq) paired amphipathic helix protein Sin3a
  KO
K11644  paired amphipathic helix protein Sin3a
Organism
ecb  Equus caballus (horse)
Pathway
ecb04919  Thyroid hormone signaling pathway
ecb05016  Huntington disease
ecb05169  Epstein-Barr virus infection
ecb05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100051174 (SIN3A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100051174 (SIN3A)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100051174 (SIN3A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100051174 (SIN3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100051174 (SIN3A)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     100051174 (SIN3A)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100051174 (SIN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sin3a_C PAH Sin3_corepress
Motif
Other DBs
NCBI-GeneID: 100051174
NCBI-ProteinID: XP_023508984
Ensembl: ENSECAG00000024605
VGNC: 22982
LinkDB All DBs
Position
1
AA seq 1274 aa AA seqDB search
MKRRLDDQESPVYAAQQRRLPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAVPQSSGSHGPTIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHNPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHSGTGATPPVKKKPKLLSLKDSSMADASKHGVGTESLFFDKVRKALRSAEA
YENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETFPKERAT
EGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVS
SKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGG
TSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWRE
QNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEDNAGVPVGPHLSL
AYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEE
EEMDVDEATGATKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLH
QILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYY
PAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQ
VTDLYLAENNNGATGGQLNTQTSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTI
ELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLARKPVFLPRNLRRIRKCQRG
REQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSH
ERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSI
NKYRVKYGTVFKAP
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccgtttggatgaccaggaatcaccggtatatgcggcccagcaacgtcggctc
cctggtagcacagaggcttttcctcaccagcaccgggtgctcgcccctgcccctcctgtg
tatgaagctgtgtccgagaccatgcagtcagccacaggaattcagtactctgtaacaccc
agctatcaggtttctgctgtgccgcagagctctggcagtcatgggcctaccatagcagcg
gttcatagcagccatcatcacccaacagctgtgcagccccacggaggccaggtggtccag
agtcatgctcatccagccccaccggtcgcaccagtgcagggacagcagcaatttcagagg
ctcaaggtggaggatgcgctgtcctatcttgaccaggtgaagctgcaatttggtagtcag
cctcaggtctacaatgatttccttgacatcatgaaggaatttaaatcccagagcatcgac
actccgggagtgattagtcgtgtgtcccagctgttcaaaggccaccctgacctgataatg
ggcttcaataccttcttgccccctggctacaagattgaggtgcaaaccaatgacatggtg
aatgtgacaactcctggccaggttcatcagatccccacccatggcatccagccccagcct
caaccaccaccccagcatccttcccagccttcagcccagtcagccccagctcctgcccag
ccggctcctcagcccccacctgccaaagtcagcaagccttcccaactacaagcacataat
ccagccagtcagcagactcccccgctcccaccatatgcatccccacgttctccacctgtc
cagcctcacacaccagtgacaatctccttgggaacggccccatccttgcagaacaatcaa
cctgtggagtttaatcatgccatcaactatgttaataagatcaagaacaggttccagggc
caaccagatatctacaaagcgttcctagagattttgcacacatatcagaaagagcagcga
aatgccaaggaagctggaggaaactacactccagcattgactgagcaggaggtctatgcc
caggtggctcgtctttttaaaaatcaggaagatctgttgtcagagtttggacagttccta
ccagatgccaacagctctgtgcttttaagcaaaacaactgctgagaaggttgattctgtc
agaaatgaccatggaggcactgtgaagaagccccaactgaacaataagccacagaggcca
agccagaatggctgccagatccgcaggcactctggaacaggagccacccctccagtgaag
aagaaacccaaactgctcagcctaaaggattcttctatggcagatgccagcaagcatggt
gtaggaactgaatcattattttttgataaggtccgaaaggctctgcggagtgcagaggcc
tatgagaatttcctgcgctgtcttgttatctttaaccaggaggtgatctctcgggctgag
cttgtgcagttagtctctcctttcctggggaaattccctgaactgtttaattggtttaaa
aactttctgggctataaggaatctgtacatctggaaacctttccaaaggaacgagccaca
gagggcattgccatggagatagattatgcctcttgtaaacggttgggctccagctatcga
gccctaccaaagagttaccagcagcccaagtgtacaggacggactcctctctgtaaagag
gttttaaatgatacctgggtttccttcccttcttggtctgaggactccacctttgttagt
tctaagaaaactcagtatgaagaacatatctatcgttgtgaagatgaacgctttgagctt
gatgtagttttagagaccaatctggcaacaatccgggttctggaagcaatacagaagaag
ctttcccgcttgtctgctgaggaacaagccaaatttcgcctggacaacacacttgggggc
acatcagaagtcattcatcgaaaagccctccagaggatatatgctgacaaagcggctgat
atcattgatgggctgaggaagaacccctccattgcggtcccaattgtccttaaaaggttg
aagatgaaagaggaagaatggcgagaagctcagagaggctttaacaaggtgtggagagaa
caaaatgagaaatactacttgaagtctctggaccaccagggcatcaactttaaacagaat
gacaccaaggtcctgaggtctaagagcttactcaatgagattgagagtatctatgatgag
aggcaagagcaggctacagaagacaatgctggtgtacctgttggcccacacctttcgctt
gcctatgaagacaaacagatcctggaagatgccgctgctctgattatccaccatgtgaag
aggcagacaggcattcagaaagaggacaagtacaaaatcaagcaaatcatgcatcatttt
attccagatctgctctttgctcagagaggggatctctcagatgtggaggaagaggaagaa
gaagagatggatgtagatgaagccacaggggcgactaagaagcacaatggtgttgggggc
agtccccctaagtccaagctactgtttagtaacacagcagctcaaaagttaagaggaatg
gatgaagtatacaacctcttctatgttaataacaactggtatatctttatgcgactacac
cagattctttgcttgaggctgctgcggatctgttcccaggctgaacggcaaattgaagaa
gaaaatcgagagagggagtgggaacgggaagtgctgggcataaagcgagacaaaagtgac
agccctgccatccagctacgtctcaaagaacctatggatgttgatgtagaagattattac
ccagctttcctggacatggtgcggagcctgctggatggtaatatagactcgtcacagtat
gaagattcgctgagagagatgttcaccattcatgcctacattgccttcaccatggacaaa
ctaatccagagcattgtcagacagctgcagcacattgtgagtgatgagatctgtgtacag
gtgactgacctttacttggcagaaaacaataatggggccactggaggccagctgaacaca
cagacttcaaggagtctcctggagtcaacatatcagcggaaggctgagcaactcatgtca
gatgagaattgctttaagcttatgttcattcagagccaaggccaggttcagctgaccata
gagcttctggacacagaagaggagaactcggatgaccctgtggaagcagagcgctggtca
gactatgtggagcgatatatgaattctgatactacctctcctgagcttcgtgagcatctg
gcacggaaaccagtatttctcccaaggaatctgcggcggatccggaagtgtcagcgtggt
cgagaacagcaggaaaaagaagggaaggaaggaaacagcaagaagaccatggagaatgtg
gatagcctggataagctggagtgtagattcaagctaaattcctacaagatggtgtatgtg
atcaagtcagaggactacatgtatcggaggactgccttgctccgggctcatcagtcccat
gagcgtgttagcaagcggctacatcagaggttccaggcctgggtagataaatggaccaag
gagcatgtgccccgtgaaatggcagcggagaccagcaagtggctcatgggtgaggggctg
gagggcctggtgccctgtaccaccacctgtgacacagagaccctgcacttcgtgagcatt
aacaagtaccgtgtcaaatacggcacagtatttaaagccccataa

DBGET integrated database retrieval system