KEGG   Equus caballus (horse): 100051217
Entry
100051217         CDS       T01058                                 

Gene name
CUL1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04120  Ubiquitin mediated proteolysis
ecb04141  Protein processing in endoplasmic reticulum
ecb04310  Wnt signaling pathway
ecb04340  Hedgehog signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04710  Circadian rhythm
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100051217 (CUL1)
   04120 Ubiquitin mediated proteolysis
    100051217 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100051217 (CUL1)
   04340 Hedgehog signaling pathway
    100051217 (CUL1)
   04350 TGF-beta signaling pathway
    100051217 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100051217 (CUL1)
   04114 Oocyte meiosis
    100051217 (CUL1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100051217 (CUL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051217 (CUL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100051217 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100051217 (CUL1)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     100051217 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 100051217
NCBI-ProteinID: XP_023495661
Ensembl: ENSECAG00000009606
VGNC: 16966
LinkDB
Position
4
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYAVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatccccatggactgaagcagatcggccttgaccagatc
tgggacgacctcagagctggaatccagcaagtgtataccagacagagtatggcgaaatcc
agatacatggaactctacactcacgtttataactactgcacaagtgttcaccagtcaaac
caagcgcgaggggctggcgtccctccttctaaatcaaagaagggacagacacctggggga
gctcagtttgttggcttggaattatacaaacgacttaaagaatttttgaagaattacttg
acaaatcttcttaaggacggagaagatttgatggatgagagtgtactgaagttctacact
cagcagtgggaagattatcgattttccagcaaagtgctgaatggaatttgtgcctacctc
aatagacattgggtgcgccgtgaatgtgatgaaggacggaaaggaatatatgaaatctat
tctcttgcattggtgacgtggcgagattgtctgttcaggccattaaataaacaggtaaca
aatgctgttttaaaactgattgaaaaggaaagaaatggtgaaaccatcaatacaagactg
ataagtggagttgtacagtcttacgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcagtttttggctgacaca
gagagattttataccagagagagtactgaattcttgcagcagaacccggtgaccgaatat
atgaaaaaggcggaggctcgtctgctggaagagcaacgaagagttcaggtctatcttcat
gagagcacacaagatgaattagcaaggaagtgtgaacaagtgctcattgagaaacatctg
gaaattttccacacagaatttcagaatttattggatgctgacaaaaatgaagatttgggt
cgcatgtataatcttgtatctaggatccaggatggcctaggagaactgaaaaaacttctg
gagacacacattcataatcagggtcttgcagcaattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtatgtacagacagtgttggatgttcataaaaagtacaatgccctg
gtgatgtcagcgttcaacaacgatgctggcttcgtggctgcgcttgacaaggcttgtggt
cgcttcataaacaacaatgcagttaccaaaatggctcagtcgtccagtaaatcgcccgag
ttgctggcccgatactgtgactccctgctcaagaagagttccaagaacccagaagaggca
gaactggaagatacactcaatcaagtgatggttgtcttcaagtacatagaggacaaagac
gtgtttcagaagttctacgccaagatgctggccaaaagactcgtccatcagaacagtgcc
agtgacgatgctgaagcaagcatgatctctaaattaaagcaagcttgtggttttgagtac
acgtctaaacttcagcggatgtttcaagacattggtgtaagcaaagatctgaatgagcag
ttcaaaaagcacctgacaaattcagaaccgctggacttggattttagtattcaagtcctg
agctccgggtcgtggcccttccagcagtcctgcacgttcgccttgccatcggagctggaa
cgtagttaccagcggttcacagctttttatgctagccgtcacagtggcagaaaattgaca
tggttatatcaactgtctaaaggagaactggtaacaaactgcttcaaaaacagatatact
ttgcaggcctctactttccagatggcaatcctgcttcagtacaacacggaagacgcctac
gccgtgcagcagctcaccgacagcacccagatcaaaatggacattttggcgcaagtcctt
cagattttattgaagtcgaagttactggtcttggaagatgagaatgcaaatgttgatgaa
gtggaattgaagccagataccttaataaaattatatcttggttataaaaataagaaatta
agggttaacatcaatgtgccaatgaaaactgaacagaagcaggaacaggaaaccacccac
aaaaatatcgaggaagaccgcaaactactgatccaggcggctatcgtgaggattatgaaa
atgaggaaggttctgaaacaccagcagctgctgggagaagtgctgactcagctgtcgtcc
agattcaagcctcgggtccccgtcattaagaaatgcattgacattctgatcgagaaagaa
tatttggagcgagttgatggtgaaaaggacacctacagttacttggcttaa

KEGG   Equus caballus (horse): 100055581
Entry
100055581         CDS       T01058                                 

Gene name
RBX1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1 isoform X1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
ecb  Equus caballus (horse)
Pathway
ecb03420  Nucleotide excision repair
ecb04066  HIF-1 signaling pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04120  Ubiquitin mediated proteolysis
ecb04141  Protein processing in endoplasmic reticulum
ecb04310  Wnt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04710  Circadian rhythm
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100055581 (RBX1)
   04120 Ubiquitin mediated proteolysis
    100055581 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100055581 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100055581 (RBX1)
   04350 TGF-beta signaling pathway
    100055581 (RBX1)
   04066 HIF-1 signaling pathway
    100055581 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100055581 (RBX1)
   04114 Oocyte meiosis
    100055581 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100055581 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055581 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100055581 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100055581 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100055581 (RBX1)
   03400 DNA repair and recombination proteins [BR:ecb03400]
    100055581 (RBX1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     100055581 (RBX1)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100055581 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     100055581 (RBX1)
   ECV complex
     100055581 (RBX1)
   Cul3 complex
     100055581 (RBX1)
   Cul4 complex
     100055581 (RBX1)
   Cul7 complex
     100055581 (RBX1)
   Cul9 complex
     100055581 (RBX1)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100055581 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100055581 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 100055581
NCBI-ProteinID: XP_001502369
Ensembl: ENSECAG00000021493
VGNC: 22259
UniProt: A0A3Q2H592
LinkDB
Position
28
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagcgaaccag
gcgtctgctacttctgaagagtgcaccgttgcgtggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccgttggacaacagagag
tgggaattccaaaagtatgggcactag

KEGG   Equus caballus (horse): 100062946
Entry
100062946         CDS       T01058                                 

Gene name
SKP1
Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04120  Ubiquitin mediated proteolysis
ecb04141  Protein processing in endoplasmic reticulum
ecb04310  Wnt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04710  Circadian rhythm
ecb05132  Salmonella infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100062946 (SKP1)
   04120 Ubiquitin mediated proteolysis
    100062946 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100062946 (SKP1)
   04350 TGF-beta signaling pathway
    100062946 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100062946 (SKP1)
   04114 Oocyte meiosis
    100062946 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100062946 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062946 (SKP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100062946 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100062946 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100062946 (SKP1)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100062946 (SKP1)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     100062946 (SKP1)
   Cul7 complex
     100062946 (SKP1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     100062946 (SKP1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100062946 (SKP1)
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 100062946
NCBI-ProteinID: XP_001504454
Ensembl: ENSECAG00000003931
UniProt: F6S4R4
LinkDB
Position
14
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcaattaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacaatctgtgactatcaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcctctaccaaatgttaatgcagcaatattaaaaaaggtcattcag
tggtgtacccaccacaaggatgaccctcctcctcctgaggatgatgagaacaaggaaaag
cggacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggaaattcgcaagaccttcaat
ataaaaaatgacttcactgaagaagaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system