KEGG   Equus caballus (horse): 100051295
Entry
100051295         CDS       T01058                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X2
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04962  Vasopressin-regulated water reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100051295 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100051295 (ADCY6)
   04371 Apelin signaling pathway
    100051295 (ADCY6)
   04072 Phospholipase D signaling pathway
    100051295 (ADCY6)
   04024 cAMP signaling pathway
    100051295 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100051295 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100051295 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100051295 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100051295 (ADCY6)
   04062 Chemokine signaling pathway
    100051295 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100051295 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100051295 (ADCY6)
   04912 GnRH signaling pathway
    100051295 (ADCY6)
   04913 Ovarian steroidogenesis
    100051295 (ADCY6)
   04915 Estrogen signaling pathway
    100051295 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100051295 (ADCY6)
   04921 Oxytocin signaling pathway
    100051295 (ADCY6)
   04926 Relaxin signaling pathway
    100051295 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    100051295 (ADCY6)
   04918 Thyroid hormone synthesis
    100051295 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100051295 (ADCY6)
   04916 Melanogenesis
    100051295 (ADCY6)
   04924 Renin secretion
    100051295 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100051295 (ADCY6)
   04927 Cortisol synthesis and secretion
    100051295 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100051295 (ADCY6)
   04270 Vascular smooth muscle contraction
    100051295 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100051295 (ADCY6)
   04971 Gastric acid secretion
    100051295 (ADCY6)
   04972 Pancreatic secretion
    100051295 (ADCY6)
   04976 Bile secretion
    100051295 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100051295 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100051295 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100051295 (ADCY6)
   04727 GABAergic synapse
    100051295 (ADCY6)
   04725 Cholinergic synapse
    100051295 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100051295 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100051295 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100051295 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100051295 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100051295 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051295 (ADCY6)
   04714 Thermogenesis
    100051295 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051295 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100051295 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100051295 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100051295 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051295 (ADCY6)
   05163 Human cytomegalovirus infection
    100051295 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100051295 (ADCY6)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100051295 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 100051295
NCBI-ProteinID: XP_001504149
Ensembl: ENSECAG00000022288
VGNC: 15091
LinkDB
Position
6
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRQRRGTRTSGFCAPRYISCLQDAQPPSPTPAAPA
QCRWQDEAFIRRGGPGKGKELGLRAVALAFEDTEAAAVARAAEVAPDVAPRSRRSCWRRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPAPPQPAYVA
LLACAAALFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSVGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMMLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRTRANSVEGLMPRWVPDRAFSRAKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLTCAVYSCGS
LFPKALQRLSRSIVRSRAHSTVVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEDTAPTCSFPEYLVGNMLLSLLASSVFLHISSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcgtggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgacaacgccgcggcacacggaccagtggtttctgtgcaccc
cgctacataagctgcctccaggatgcacagccacccagccccacccctgcagctcccgct
cagtgccgctggcaggatgaggccttcatccggaggggtggcccaggcaagggcaaggag
ctggggctgcgggccgtggccctggcctttgaggacactgaggcagcagcagtggccagg
gcggctgaggtggcgcctgatgtggcccccaggagcagacgatcctgctggcgccgtctg
gtgcaggtgttccagtcgaagcagttccgctcagccaagctggagcgcctgtaccagcgg
tacttctttcagatgaaccagagcagcctgacgctgctgatggcggtgctcgtgctgctc
acagctgtgctgctggccttccatgctgcgcctgcccctcctcagcctgcctacgtggcc
ctgctggcctgtgccgctgccctctttgtggcacttatggtggtgtgtaaccgacacagc
ttccgccaggactccatgtgggtggtaagctacgtggtgctaggcatcctggcagccgtg
caggtcggcggtgccctggcagccaacccccacagcccctctgtaggcctctggtgccct
gtgttctttgtctacatcacctacacgctcctacccatccgcatgcgggcagctgtcttc
agcggcctgggcctctccaccctgcatttgatcttggcctggcaactcaaccgtggtgac
gccttcctctggaagcagctcggtgccaacatgatgctgttcctctgcaccaacgtcatc
ggcatctgcacacactacccagctgaggtgtctcagcgccaggcctttcaggagacccgc
ggttatatccaggcccggttgcacctgcagcatgagaatcggcagcaggagcggctgctg
ctgtcggtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgttt
gcggacattgaaggcttcaccagcctggcatcccagtgtactgcacaggagctggtcatg
accctgaatgagctctttgcccgctttgacaagctggctgcggaaaatcattgcctgagg
atcaagatcttaggggactgttattactgtgtgtcagggctgccagaggcccgggcagac
cacgcccactgctgtgtggagatgggggtggacatgattgaggccatctcgctggtacgt
gaggtgacaggtgtgaatgtgaacatgcgcgtgggcatccacagtgggcgcgtgcactgc
ggtgtccttggcctgcggaaatggcagttcgatgtgtggtccaatgatgtgactttggcc
aaccacatggaagctgggggccgggctggccggatccacatcactcgagccacactgcag
tacctgaatggggactatgaggtggagccgggccgtggtggcgagcgcaatgcatacctc
aaggagcagcacatcgagaccttcctcatcctgggagccagccagaaacggaaggaggag
aaggccatgctggccaagctgcagcgaacgcgggccaactccgtggaagggctgatgcca
cgctgggtgcctgaccgtgccttctcccgggccaaggactccaaagctttccgccagatg
ggcattgatgattccagcaaagacaaccggggtgctcaagatgccctgaaccctgaggat
gaggtagacgaattcctgggccgtgccattgatgcccgcagcatcgatcagctgcgcaag
gaccatgtgcgccgtttcctgctcaccttccagagagaggaccttgaaaagaagtactcg
cggaaggtggacccccgcttcggagcctatgtggcctgtgccctgttggtgttctgcttc
atctgcttcatccagctcctcatcttcccacattcaaccctgatgcttgggatctatgcc
agtatcttcttgctgttgctgatcactgtgctgacctgtgccgtgtactcctgtggctct
ctcttccctaaggcgctgcaacgtctgtcgcgcagcattgtccgctcgcgggcacacagc
accgtggttggcatcttttcagtcctgcttgtgttcacctccgccatcgccaacatgttc
acctgtaaccacaccccaatacggacctgcgcagcccggatgctgaatttaacacctgcc
gacatcactgcctgccacctgcagcaactcaattactctctgggcctggatgctcccctc
tgtgaggacaccgcacctacctgcagcttccctgagtacttggtcgggaacatgctgctg
agtctcttggccagctctgtcttcctgcacatcagtagcatcgggaagttggccatgatc
tttgtcctggggctcatctacttggtgctgcttctgctgggtcccccagccaccatcttt
gacaactatgacctgctgcttggcgtccatggcttggcttcttccaatgagaccttcgat
gggctggactgcccagctgcagggagggtggcactcaaatacatgactcccgtgattctg
ctggtgttcgcgctggcgctctatctgcatgcccagcaggtggaatcaactgcccgcctg
gacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctccaggca
tacaaccggcggctgctgcataacattctgcccaaggacgtggctgcccacttcctggcc
cgggagcgccggaacgatgaactctactatcagtcttgtgagtgtgtggctgtcatgttc
gcctccattgccaacttctctgagttctacgtggagctggaggcaaacaatgagggcgtc
gagtgcttgcggctgctcaatgagatcattgctgactttgatgagatcatcagcgaggag
cggttccggcagctggagaagatcaagacgattggtagcacctacatggctgcctccggg
ctgaacgccagcacctatgatcaggtgggccgctcccacatcactgccctcgccgactat
gccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagattgggctgaacatgggcccagttgtggcaggcgtcattggggctcggaagccg
cagtatgacatctgggggaacacagtgaatgtctctagccgtatggacagcacgggggtc
cctgaccgaattcaggtgaccacggacctgtaccaggttctagctgccaagggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

KEGG   Equus caballus (horse): 100054305
Entry
100054305         CDS       T01058                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100054305 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100054305 (ADCY4)
   04371 Apelin signaling pathway
    100054305 (ADCY4)
   04020 Calcium signaling pathway
    100054305 (ADCY4)
   04072 Phospholipase D signaling pathway
    100054305 (ADCY4)
   04024 cAMP signaling pathway
    100054305 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100054305 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100054305 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100054305 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100054305 (ADCY4)
   04062 Chemokine signaling pathway
    100054305 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100054305 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100054305 (ADCY4)
   04912 GnRH signaling pathway
    100054305 (ADCY4)
   04913 Ovarian steroidogenesis
    100054305 (ADCY4)
   04915 Estrogen signaling pathway
    100054305 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100054305 (ADCY4)
   04921 Oxytocin signaling pathway
    100054305 (ADCY4)
   04926 Relaxin signaling pathway
    100054305 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100054305 (ADCY4)
   04918 Thyroid hormone synthesis
    100054305 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100054305 (ADCY4)
   04916 Melanogenesis
    100054305 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100054305 (ADCY4)
   04927 Cortisol synthesis and secretion
    100054305 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100054305 (ADCY4)
   04270 Vascular smooth muscle contraction
    100054305 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100054305 (ADCY4)
   04971 Gastric acid secretion
    100054305 (ADCY4)
   04972 Pancreatic secretion
    100054305 (ADCY4)
   04976 Bile secretion
    100054305 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100054305 (ADCY4)
   04727 GABAergic synapse
    100054305 (ADCY4)
   04725 Cholinergic synapse
    100054305 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100054305 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100054305 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100054305 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100054305 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100054305 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100054305 (ADCY4)
   04714 Thermogenesis
    100054305 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054305 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100054305 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100054305 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100054305 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100054305 (ADCY4)
   05163 Human cytomegalovirus infection
    100054305 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100054305 (ADCY4)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100054305 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100054305
NCBI-ProteinID: XP_005603310
Ensembl: ENSECAG00000013004
VGNC: 15089
UniProt: F6ZH58
LinkDB
Position
1
AA seq 1077 aa
MARLFSPRPQPSEDLFYETYYSLSQQYPLLLMLLAIVLCALLALLAVAWASGRELASDTG
FLTTVLCALGGFSLLLGLASREHRLQRWTRPLSGLVWAALLALGYSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLGMRDATAAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYTACTFLVFLSIFI
VQMLVTNRPPALAITYSITFLLFLLLLFICFSEHLTRCVLKGPKVLHWLPALSGLVSTRP
GLRVALGTATILLVFAMAITSLFFLPPASKCPFQAPNVSSMALNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSLFLHSHAWLSDCLIARLYLGPADS
RPGVLKEPKMMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFTVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSAALG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgcagcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctaatgctgctggccatcgtgctctgcgcg
ctcctggcgctgctcgcggtcgcctgggccagtggcagggagctggcctctgacacgggc
ttcctgaccactgtgctgtgcgcgttgggcggcttctcgttgctgctgggcttggcttcc
cgcgagcaccgactgcagcgctggacgcgtcccctgtccggcctcgtgtgggcagcgctg
cttgcgctaggctacagcttcctgttcaccgggggcgtggtgagcgcctgggaccaggta
tcctttttcctctttgtcatcttcacggtctatgccatgctgcccttgggcatgcgggac
gccaccgccgcgggcctcgcctcctcactctcacatctgctggttcttgggctgtatctt
gggcctcaacccgactctaggcccgcgctgctgcctcagctggcagcaaacgcggtattg
ttcctgtgcgggaacgtggctggagcgtaccacaaggcgctgatggagcgcgccctgcgc
gccacgttccgggaggcgctgagttccctgcactcgcgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccaagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccatagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgaggctggccagtgagtgctcccctaaagagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgccactctcgctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccactggt
gtggacatcaacatgcgtgtgggtgtgcactcaggcagcgtgctctgcggagtcatcggg
ctgcagaagtggcagtacgatgtctggtcgcatgacgtcacactggccaaccacatggag
gccggtggcgtgccagggcgcgtacatatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcagccatggaacaccgagacccgtaccttcgggagctaggg
gagcctacctacctggtcatcgatccccgggctgaggaagaggatgagaagggcactgca
ggagggttgctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagagagccca
gtgtccacctccactcctctcccggagaaggccctggcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgaggaattggacaccggggatgccaag
ttcttccaggtcattgaacagctcaactctcagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttccgagagaaggagatggagaaagagtatcgactctctgca
ctccccgccttcaaatactacacagcctgcaccttcctggtttttctctccatcttcatc
gtccagatgctggtgacaaacaggcccccagctctggccatcacctatagtatcaccttc
ctcctcttcctcctcctcctcttcatctgtttctcagagcacctgacgaggtgtgtcttg
aaaggccccaaggtgctacactggctgcctgcactgtctggcctggtgtccacacggccc
ggactgcgagtcgccctgggcaccgccaccatccttctcgtcttcgccatggccattacc
agcctgttcttcttaccgccagcatcgaagtgccctttccaggctcccaatgtgtcctcc
atggctttgaacctctcctgggagctccctgggtccctgcctctcatcagcatcccatac
tccatgcactgctgcgtgctgggtttcctctcctgctccctctttctgcacatgagcttc
gaactgaagctgctgctgctcctgctgtggctgacggcctcctgctccctcttcttgcac
tcccacgcctggctgtctgactgcctcatcgcccgcctctatctgggccccgcggattcc
aggccaggggtgctgaaggagcccaaaatgatgggcgctatctccttcttcatcttcttc
tttaccctccttgtcctggctcggcagaatgaatattactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacaatggagaacctgacccggctg
ctcttggagaatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcgtacgagtgtgtttgtgtcctcttcgcctccgtccca
gacttcaaggagttttactctgaatccaatatcaaccacgagggcctagagtgtctgcgg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaaattcagtggc
gtggagaagatcaaaaccattggcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggacgcacagcaggatgctgagcgaagttgcagccaccttggcaccatggtg
gaattcacggtggccctcgggtctaagctagatgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtgggattgaaccacggaccagtagtggctggagtgattggggcccag
aagccacaatacgacatctggggcaacacggtgaacgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaagagacagctcgggccctgcagtctttaggc
tacacctgctacagccggggtgtcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggacctccctctgccgccctgggctga

KEGG   Equus caballus (horse): 100055961
Entry
100055961         CDS       T01058                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04740  Olfactory transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04962  Vasopressin-regulated water reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100055961 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100055961 (ADCY3)
   04371 Apelin signaling pathway
    100055961 (ADCY3)
   04020 Calcium signaling pathway
    100055961 (ADCY3)
   04072 Phospholipase D signaling pathway
    100055961 (ADCY3)
   04024 cAMP signaling pathway
    100055961 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100055961 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100055961 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100055961 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100055961 (ADCY3)
   04062 Chemokine signaling pathway
    100055961 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100055961 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100055961 (ADCY3)
   04912 GnRH signaling pathway
    100055961 (ADCY3)
   04913 Ovarian steroidogenesis
    100055961 (ADCY3)
   04915 Estrogen signaling pathway
    100055961 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100055961 (ADCY3)
   04921 Oxytocin signaling pathway
    100055961 (ADCY3)
   04926 Relaxin signaling pathway
    100055961 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100055961 (ADCY3)
   04918 Thyroid hormone synthesis
    100055961 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100055961 (ADCY3)
   04916 Melanogenesis
    100055961 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100055961 (ADCY3)
   04927 Cortisol synthesis and secretion
    100055961 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100055961 (ADCY3)
   04270 Vascular smooth muscle contraction
    100055961 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100055961 (ADCY3)
   04971 Gastric acid secretion
    100055961 (ADCY3)
   04972 Pancreatic secretion
    100055961 (ADCY3)
   04976 Bile secretion
    100055961 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100055961 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100055961 (ADCY3)
   04727 GABAergic synapse
    100055961 (ADCY3)
   04725 Cholinergic synapse
    100055961 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100055961 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100055961 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100055961 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100055961 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100055961 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100055961 (ADCY3)
   04714 Thermogenesis
    100055961 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055961 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100055961 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100055961 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100055961 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100055961 (ADCY3)
   05163 Human cytomegalovirus infection
    100055961 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100055961 (ADCY3)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100055961 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 100055961
NCBI-ProteinID: XP_023475169
Ensembl: ENSECAG00000008344
VGNC: 15088
LinkDB
Position
15
AA seq 1143 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRRVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLVLDLI
LFVLCKKGLLPDRVTRRVVPYLLWLLLTAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCGVHTLVLGVTVAQQQQDGLKGMQLLREILANVFLYLCAIIVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPTSSKPSSPALIETKEPNGSVHT
SGSTSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVGASEDEHELNQLLSEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCAALVEILIDPWLMTN
YVTFVVGEVLLLVLTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPNNSTMGMEVDDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAVINIYAWRPIFDEYDHKRFQEHELIALEKMQVFSTPGLNGTDRLPLVPSKYS
MTVMVFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVA
RHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDS
LLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADFAL
AMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMG
NIQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAFPNGSSVTLPHQVV
DNS
NT seq 3432 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccctgagtactctgctgagtactcggctgagtac
tctgtcagcctgccctctgaccctgaccgcagggtgggccggacccatgaaatctctgtc
cggaactcgggctcctgcctctgcctgcctcgcttcatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgtgcagtggtcttc
tccagcgacaagctggctcccctggtcgtggccgggatcggcctggtgttggacctcatc
ctcttcgtgctctgcaaaaaggggctgctccccgaccgggtcacccggagagtggtgccc
tacctgctgtggctgctgctaacagctcagatcttctcctacctgggcctgaacttctcc
cgcgcccacgcggccagcgacacggtgggctggcaggcgttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgtggcgtg
cacacgctcgtcctcggggtcactgtggcccagcaacagcaggatgggctgaaggggatg
cagttgctgagggagatcctggccaacgtcttcctctacctgtgcgccatcatcgtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggccgacgagatgctaaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcgtctgcctgcagtgcccaggagctc
gtgaaactgctcaacgagctctttgcccgcttcgacaagctggcagccaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtggcctgccggactaccgg
gaggaccacgctgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagactggggtggacatgcgtgtgggggtgcacacgggcactgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtccactgacgtcact
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagtttgacgtggagccaggcgacgggggcagccgctgcgat
tacctagaagagaagggcatcgaaacctacctcatcatcgcgtccaagccggaagtgaag
aaaacagccacccaaaatggcctcaacggctcggccctcccaaatggagcaccaacttct
tcaaagcccagctcccctgccctcattgagaccaaggaacccaatgggagtgtccacacc
agcggttccacatctgaggagcccgaagagcaagatgcccaggctgacaacccctccttc
cccaatcctcgccggaggctgcgccttcaggacctggccgatcgagtggtgggtgcctct
gaggacgagcatgaactcaaccagctgctcagtgaggcgctgctcgagcgcgagtctgcc
caggtagtgaagaagagaaacacctttctcctatccatgcggttcatggaccctgagatg
gaaacccgctactcggtggagaaggaaaagcagagtggggctgccttcagctgctcctgc
gttgtcctgctctgtgcggccctggtcgagatactcattgacccttggctaatgacaaac
tatgtgacctttgtggttggggaggttctgcttctggtcctgacaatctgctcgctggct
gctatctttccccgggcctttcctaagaagctcgtggccttctcaacatggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattttggttatggccaac
gttgtggacatgcttagctgtctccagtactacactggacccaacaacagcaccatgggg
atggaggtggacgatggctgcgtggagaaccccaagtattacaactatgtcgctgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcacgggtgctgtggccgtcatcaacatctatgcctggcgccccatctttgat
gaatatgaccacaaacgttttcaggaacatgaattgattgccttagagaagatgcaagtg
ttttccacccctgggctcaatggcactgacaggctccccctggtgccttctaagtactcg
atgacagtgatggtcttcatcatgatgctgagcttttactacttctcccgccacgtggaa
aaactggcacggacactgttcttgtggaagattgaggtccatgaccagaaggaacgtgtc
tatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtggca
cgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttacgatgag
attggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagcatc
aataatggcggcatcgagtgtctgcgcttcctcaatgagatcatctcagactttgactct
ctcctggacaatcctaaattccgggtcatcaccaagatcaaaaccattggcagcacctat
atggcagcttcaggagtcaccccagatgtcaacaccaacggctttaccagctccaacaag
gaggaaaagtcggacaaggagcgctggcagcacctggctgatctggctgactttgcatta
gccatgaaggatacacttacaaacatcaacaaccagtccttcaacaatttcatgctgcgt
ataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaaccgcactat
gacatctggggcaatacagtcaacgtagccagcaggatggagtccacaggggtcatgggc
aacattcaggtggtggaagaaacacaagccatccttcgagagtacggcttccgatttgtg
aggcgagggcccatctttgtgaaagggaagggggagctgctgacctttttcttgaaggga
cgtgacaagccagctgccttccctaacggctcctctgttacactgccccaccaggtggta
gacaactcctga

KEGG   Equus caballus (horse): 100057796
Entry
100057796         CDS       T01058                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100057796 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100057796 (ADCY8)
   04371 Apelin signaling pathway
    100057796 (ADCY8)
   04020 Calcium signaling pathway
    100057796 (ADCY8)
   04072 Phospholipase D signaling pathway
    100057796 (ADCY8)
   04024 cAMP signaling pathway
    100057796 (ADCY8)
   04022 cGMP-PKG signaling pathway
    100057796 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100057796 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100057796 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100057796 (ADCY8)
   04062 Chemokine signaling pathway
    100057796 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    100057796 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    100057796 (ADCY8)
   04912 GnRH signaling pathway
    100057796 (ADCY8)
   04913 Ovarian steroidogenesis
    100057796 (ADCY8)
   04915 Estrogen signaling pathway
    100057796 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    100057796 (ADCY8)
   04921 Oxytocin signaling pathway
    100057796 (ADCY8)
   04926 Relaxin signaling pathway
    100057796 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    100057796 (ADCY8)
   04918 Thyroid hormone synthesis
    100057796 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    100057796 (ADCY8)
   04916 Melanogenesis
    100057796 (ADCY8)
   04925 Aldosterone synthesis and secretion
    100057796 (ADCY8)
   04927 Cortisol synthesis and secretion
    100057796 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100057796 (ADCY8)
   04270 Vascular smooth muscle contraction
    100057796 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    100057796 (ADCY8)
   04971 Gastric acid secretion
    100057796 (ADCY8)
   04972 Pancreatic secretion
    100057796 (ADCY8)
   04976 Bile secretion
    100057796 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    100057796 (ADCY8)
   04727 GABAergic synapse
    100057796 (ADCY8)
   04725 Cholinergic synapse
    100057796 (ADCY8)
   04720 Long-term potentiation
    100057796 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    100057796 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    100057796 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    100057796 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    100057796 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    100057796 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100057796 (ADCY8)
   04714 Thermogenesis
    100057796 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057796 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    100057796 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100057796 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100057796 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100057796 (ADCY8)
   05163 Human cytomegalovirus infection
    100057796 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100057796 (ADCY8)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100057796 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 100057796
NCBI-ProteinID: XP_001916535
Ensembl: ENSECAG00000024601
VGNC: 15092
UniProt: F6R859
LinkDB
Position
9
AA seq 1252 aa
MELSDVRCLSGSEELYTIHPTPPAGDGGSASRPQRLLWQTAVRHITEQRFIHGHRGSGGG
GGSGGSGKASDPTGGGPNHHASQLSSDSALPLYSLGPGERAHSSGGTKVFPERSGSGSGS
GSGGGGDLGFLHLDCAPSNSDFFLSGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRR
KSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSH
TYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGT
SLLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEA
RLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFAD
VKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHA
HCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANK
LESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPE
DIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCA
FIVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWIN
ETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFT
GVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKE
ASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHV
ARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFD
ELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQHCEDKWGHLCALADFSLALTESIQEINK
HSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLI
LKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRMPGQYSLAAVVLGL
VQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGTQAEGTDKSDLP
NT seq 3759 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcgcctctcggccgcagcggctgctgtggcagacg
gcggtgaggcacatcaccgagcagcgcttcattcacgggcaccggggcagcggcggcggc
ggcggaagcggaggctccggcaaagcctcggaccctacaggcggcggccccaatcaccat
gcgtcgcagctgtccagcgactccgcgctgcccctctactcgctgggccccggggagaga
gcgcacagcagcggcggcaccaaagtcttcccggaacgcagcgggagcgggagcggcagc
ggcagcgggggcgggggcgacctgggcttcctgcacctcgactgcgccccgagcaactcg
gatttcttcctcagtgggggctatagctaccgaggggtcatttttcctaccctgcgcaac
tccttcaagtcccgggatctggagcgcctctaccagcgctatttcctgggccagagacgc
aaatctgaggtggtgatgaacgtgctggacgtgctcaccaaactcaccctcttggttctc
cacttgagcctggcctcagcccccatggacccgctcaagggtatcctgctgggtttcttc
actggcatcgaggtcgtgatttgcgccctggtggtggtcaggaaggacaccacctcgcac
acgtacctgcaatacagcggcgtggtcacctgggtggccatgaccacccagatcctggca
gcaggcctgggctacgggctcctgggtgatggcatcggctacgtgctctttacactcttc
gccacctacagcatgctgccactgcccctcacctgggccatcctggccggcctgggcacc
tcgctgctgcaggtcatcctccaagtggtcatcccccggctggcggtcatttccatcaac
caggttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatctttatcagt
tacctgtcagaccgggcccagcgccaagccttcctggagacacggaggtgtgtggaggcc
aggctgcgcctggaaacggaaaaccaaagacaggagcggctggtgctatctgtgctcccc
cggtttgtcgtcctggaaatgatcaacgacatgaccaatgtggaagacgagcacctgcag
caccagttccatcggatctacatccatcgctacgagaacgtcagtattctttttgcagat
gttaaaggatttaccaacctctccacgaccttgtccgctcaggagctggtcaggatgctc
aacgagctctttgccagatttgatcgactagcccatgagcatcactgccttcgcatcaaa
atcctgggagactgctactactgtgtttccggacttcctgagccccgccaggaccacgcc
cactgctgcgtggaaatgggcctcagcatgatcaaaaccatcaggtatgtacggtcaagg
acaaagcatgatgttgacatgaggatcggaattcactcaggctcagtgctatgtggcgtt
ttgggactacggaagtggcagtttgatgtctggtcttgggatgtggacattgcaaacaaa
cttgaatctggaggaatcccggggaggattcacatttccaaagccacgctggactgtctc
aacggtgactataacgtggaagagggtcacgggaaagagaggaacgaattcttgaggaag
cataatatagagacctatttaattaagcagcctgaagagagtctgctgtccttgcccgaa
gacattgtcaaggagtctgtgagctcctcagacaggagaaacagtggggcgacgttcacg
gaaggatcttggagccccgaactgcccttcgataacatagtggggaaacagaacactctg
gctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcat
gtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagt
ggcgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagc
ctggagcacaagtattctcaaatgagagatgaagtattcaagtcaaacttggtctgtgcg
ttcatcgttcttctatttatcacggcaatacaaagtttgcttccttcttcaagggtgatg
ccaatgaccatccagttttccatcctgattatgctgcactcagctctggtcctcatcacc
acagcagaggactataagtgtttgcccctcgtcctccggaaaacttgctgttggattaac
gagacttatttggcccggaatgtcatcatctttgcatccatcttgattaatttcctggga
gccatcctaaatattctgtggtgtgattttgacaagtcgatacccttgaagaacctgact
ttcaattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcact
ggggtgctggccatggtgacctgtgcggttttcctccgactgaactctgtcctgaagctg
gccgtgctgctgatcatgatcgccatctacgccctgctgaccgagaccatctatgcaggt
ctctttctgcgctacgacaacctgaaccacagtggagaagatttcctggggaccaaggag
gcgtcgctgctgctgatggccatgttcctccttgctgtgttctaccacggacagcagctg
gagtacacagcccgcctggacttcctttggcgagtacaggccaaagaggagatcaatgag
atgaaggagctgagggaacacaatgagaacatgctccggaacatcttacccagtcacgtg
gcccgccatttcctggagaaagaccgagacaatgaggagctgtattctcaatcctatgat
gccgttggggtgatgttcgcctccatcccagggtttgcagacttttactctcagaccgaa
atgaataaccaaggagtggaatgcctgcgcctcctgaatgagatcattgctgactttgat
gagctgctcggcgaagaccggtttcaagacattgaaaaaattaagaccattggcagcacc
tacatggctgtgtcaggcttgtcacctgaaaaacagcactgtgaagacaagtggggccat
ctgtgtgctctggctgacttctccctcgccctgaccgaaagcatacaggagatcaacaag
cattccttcaacaactttgaactccggattggcatcagccacggctcagtggtagctggt
gtaattggcgctaagaaacctcagtatgacatttggggcaaaaccgtgaacctggcaagt
cgaatggacagcacgggggtcagcggcaggatccaagtcccagaggagacctatctcatc
ctgaaggaccagggctttgcctttgactaccgaggggagatctacgtgaaaggtatcagc
gaacaggagggaaagatcaaaacgtactttctcctgggaagagtccagcccaacccgttc
atcttgcccccgagaagaatgcccgggcagtactccttggccgcggtcgtcctgggcctc
gtccagtccctcaacaggcaaaggcagaagcagctactcaacgagaacaacaacacgggc
atcatcaagggccattacaaccggcggactttgttgacacccagtgggccagagcctgga
acccaagccgaaggcaccgacaagtccgatttgccataa

KEGG   Equus caballus (horse): 100058891
Entry
100058891         CDS       T01058                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100058891 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100058891 (ADCY7)
   04371 Apelin signaling pathway
    100058891 (ADCY7)
   04020 Calcium signaling pathway
    100058891 (ADCY7)
   04072 Phospholipase D signaling pathway
    100058891 (ADCY7)
   04024 cAMP signaling pathway
    100058891 (ADCY7)
   04022 cGMP-PKG signaling pathway
    100058891 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100058891 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100058891 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100058891 (ADCY7)
   04062 Chemokine signaling pathway
    100058891 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    100058891 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    100058891 (ADCY7)
   04912 GnRH signaling pathway
    100058891 (ADCY7)
   04913 Ovarian steroidogenesis
    100058891 (ADCY7)
   04915 Estrogen signaling pathway
    100058891 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    100058891 (ADCY7)
   04921 Oxytocin signaling pathway
    100058891 (ADCY7)
   04926 Relaxin signaling pathway
    100058891 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    100058891 (ADCY7)
   04918 Thyroid hormone synthesis
    100058891 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    100058891 (ADCY7)
   04916 Melanogenesis
    100058891 (ADCY7)
   04925 Aldosterone synthesis and secretion
    100058891 (ADCY7)
   04927 Cortisol synthesis and secretion
    100058891 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100058891 (ADCY7)
   04270 Vascular smooth muscle contraction
    100058891 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    100058891 (ADCY7)
   04971 Gastric acid secretion
    100058891 (ADCY7)
   04972 Pancreatic secretion
    100058891 (ADCY7)
   04976 Bile secretion
    100058891 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100058891 (ADCY7)
   04727 GABAergic synapse
    100058891 (ADCY7)
   04725 Cholinergic synapse
    100058891 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    100058891 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100058891 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    100058891 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    100058891 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100058891 (ADCY7)
   04714 Thermogenesis
    100058891 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058891 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    100058891 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100058891 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100058891 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100058891 (ADCY7)
   05163 Human cytomegalovirus infection
    100058891 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100058891 (ADCY7)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100058891 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N PsbI
Other DBs
NCBI-GeneID: 100058891
NCBI-ProteinID: XP_023492707
LinkDB
Position
3
AA seq 1079 aa
MPAKGRYFLNEGEEDPDEHALYEKYRLTSQHGPLLLTLLLVAIAACVALIVITFSQGDPS
RNPAVLGTVFLMLAVFVALYVLVYVECLVRRWLRASALLIWACLVTLGYVLVFDSWRKAA
CAWQQVPFFLFVVFVVYTLLPFSMQGAIMVGVISSTSHLLVLGTVMEIFTKPSVSVGLQL
LAVAVVFLCVNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIEKLKERGDRRCVPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LNHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPKPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSSEPPVPSGRRPKAIPLRRHRTPDRSTSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSTSDDFHACGFIFQEKGSEREYRLAPIPRARHYFACA
SLVFVCILLVHVLLMPRMAALGVSFGLVACVLGLVLGLCFADEILRCCPAWGTLRAISER
VETHPLLRLSLAVLTIGSLLTIAIVNLPLTPFPAMELPAGNETNLRSVSSREKALCELLL
YYTCSCILAFVACSVFLRMSLELKVVLLTVALVAYLVLLNIAPCWQWGCCGHSLGNVTKT
NSTLSSPSCSWRDLQTTINFALVLFYVTLALLSRQIDYYCRLDCLWKKKFKKEHEEFETM
ENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEG
LECLRLLNEIVADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVPSGHDNQDLERQHAHI
GIMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASR
MESTGELGKIQVTEETSAILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGPN
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgccggccaaggggcgctacttcctcaacgagggcgaggaggacccggacgaacacgca
ctctacgagaagtaccgcctcaccagccagcacgggccgctgctgctcacgctcctgctg
gtggccatcgccgcctgcgttgcactcatcgtcatcaccttcagccagggggacccctcc
agaaacccggctgtcctggggacagtattcttaatgctcgccgtgtttgtggctctctat
gtgctggtgtatgtcgagtgcctcgtccggcggtggctcagggcctcagcactgctcatc
tgggcctgccttgtgacgctgggctacgtgctggtgtttgactcgtggaggaaggcggcc
tgtgcgtggcagcaggtgcccttcttcctgttcgttgtcttcgtggtgtacacactgctg
cccttcagcatgcagggggccataatggtgggggtcatctccagcacctcccacctcctg
gtgcttggcactgtcatggagatcttcacaaagcccagcgtcagcgtggggctgcagctg
ctggctgttgccgttgtcttcctgtgcgtgaacctcacgggcgccttccataagcaccag
atgcaggacgcctcccgtgacctcttcacctacactgtgaagtgcatccagatcaggcgt
aagctgcgcattgagaagcgccagcaggagaacttgctgctgtcagtgctgccggcgcac
atctccatgggcatgaagctggccatcatcgagaagctcaaggagcggggggaccgccgc
tgtgtgccggacaacaacttccacagcctctacgtgaagcggcaccagaacgtcagcatc
ctctacgctgacatcgtgggcttcacgcagctggccagcgactgttcccctaaggagctg
gtggtggtgctgaacgagctcttcggcaagttcgaccagatcgccaaggccaatgagtgc
atgcggatcaagatcctgggcgactgctactactgcgtgtcgggcctgcccgtgtccctg
cccacccatgcccggaactgtgtgaagatggggctcgacatgtgcgaggccattaagcag
gtgcgggaggccacgggcgtggacatcagcatgcgtgtgggtatacattcaggaaacgtg
ctgtgtggtgttattgggctgcgcaagtggcagtacgacgtgtggtcccatgacgtgtcc
ctggccaaccggatggaggcggctggagtccccggccgggtgcacatcacagaggcgacg
ctgaaccacctggacaaggcgtacgaggtggaagatgggcacgggcagcagcgagacccc
tacctgaaagagatgaacattcgcacctacctggtcatcgacccccggagccagcagcca
cccccgcccagccaacacctccccaagcccaagggggatgcggccctgaagatgcgggcg
tccgtgcgcatgacccgctacctcgagtcctggggggcggcacggcccttcgcacacctc
aaccaccgcgagagcgtgagcagcagcgagcctcctgtccccagcgggcggaggcccaag
gccattcccctgcggcgccatcggacccctgacagaagtacatcccccaaggggcggtct
gaggacgactcctacgatgacgagatgctctcagccatcgaagggctcagctccaccagg
ccctgctgctccacgtccgacgacttccatgcctgcgggttcatcttccaggagaagggc
tccgagcgagagtaccgcctggcgcccatcccccgggcccgtcactactttgcctgtgcc
agtctcgtcttcgtctgcatcctgctcgtccatgtcctgctgatgcccaggatggcagct
ctgggcgtgtccttcgggctggtggcctgcgtgctggggttggtgctgggcctgtgcttt
gctgacgagatcttgaggtgctgcccagcctgggggacactccgggccatctctgagagg
gtggagacgcatcccctgctgcggctgtccctggctgtgctgaccatcggcagcctgctc
accattgccatcgtcaacctgccgctgactccgttcccagccatggagctgcctgctggc
aatgagacaaacctgaggtctgtgagcagcagggagaaggccctgtgcgagctcctcctg
tattacacctgcagctgcatcctggcctttgtggcttgctctgttttcctgcggatgagc
ctggagctgaaggtcgtgcttttgacagtggccttggtggcctacctggtgcttctcaac
atcgccccatgctggcagtggggctgctgtggccacagcctgggcaacgtcaccaagacc
aacagcaccctcagctccccttcctgctcgtggagggacctgcagacgacgatcaacttc
gccctggttctgttttacgtcaccctcgccttgctgtcccgacagattgactattactgc
cgcttggattgtttgtggaagaagaagttcaagaaggagcacgaggagtttgaaaccatg
gagaacgtgaaccgcctgcttctggagaatgtgctgccagcccacgtggccgcccacttc
attggtgacaagttaaacgaggactggtaccatcagtcgtacgactgcgtctgtgtcatg
tttgcgtccgtgccagacttcaaagtgttctacactgagtgtgacgtcaacaaggaaggc
ctggagtgtctgcgcctgctgaacgagattgtcgctgactttgacgagctcctgctaaag
cccaagttcagtggtgtggagaagatcaagaccatcggcagcacgtacatggcagctgca
gggctcagtgtcccctcagggcacgacaaccaggacctggagcgccagcatgcccacatt
ggcatcatggtggagttcagcatcgccctgatgagcaagctggacggcatcaacaggcac
tccttcaactccttccgcctccgagtcggcataaaccacgggcctgtgattgctggagtg
atcggggcgcgaaaacctcagtatgacatctggggaaacacggttaacgttgccagccga
atggagagcactggggaacttgggaaaatccaggttaccgaagagacaagtgccatcctc
cagggactaggttattcttgtgaatgccgtggactgatcaacgtcaaaggcaaaggcgag
ctgaggacttactttgtctgtacagacactgccaagtttcaagggctggggcccaactga

KEGG   Equus caballus (horse): 100065563
Entry
100065563         CDS       T01058                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100065563 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100065563 (ADCY1)
   04371 Apelin signaling pathway
    100065563 (ADCY1)
   04020 Calcium signaling pathway
    100065563 (ADCY1)
   04072 Phospholipase D signaling pathway
    100065563 (ADCY1)
   04024 cAMP signaling pathway
    100065563 (ADCY1)
   04022 cGMP-PKG signaling pathway
    100065563 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100065563 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100065563 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100065563 (ADCY1)
   04062 Chemokine signaling pathway
    100065563 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    100065563 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    100065563 (ADCY1)
   04912 GnRH signaling pathway
    100065563 (ADCY1)
   04913 Ovarian steroidogenesis
    100065563 (ADCY1)
   04915 Estrogen signaling pathway
    100065563 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    100065563 (ADCY1)
   04921 Oxytocin signaling pathway
    100065563 (ADCY1)
   04926 Relaxin signaling pathway
    100065563 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    100065563 (ADCY1)
   04918 Thyroid hormone synthesis
    100065563 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    100065563 (ADCY1)
   04916 Melanogenesis
    100065563 (ADCY1)
   04925 Aldosterone synthesis and secretion
    100065563 (ADCY1)
   04927 Cortisol synthesis and secretion
    100065563 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100065563 (ADCY1)
   04270 Vascular smooth muscle contraction
    100065563 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    100065563 (ADCY1)
   04971 Gastric acid secretion
    100065563 (ADCY1)
   04972 Pancreatic secretion
    100065563 (ADCY1)
   04976 Bile secretion
    100065563 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100065563 (ADCY1)
   04727 GABAergic synapse
    100065563 (ADCY1)
   04725 Cholinergic synapse
    100065563 (ADCY1)
   04720 Long-term potentiation
    100065563 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    100065563 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100065563 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    100065563 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    100065563 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100065563 (ADCY1)
   04714 Thermogenesis
    100065563 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100065563 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    100065563 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100065563 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100065563 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100065563 (ADCY1)
   05163 Human cytomegalovirus infection
    100065563 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100065563 (ADCY1)
   05142 Chagas disease
    100065563 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100065563 (ADCY1)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100065563 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 100065563
NCBI-ProteinID: XP_005614918
Ensembl: ENSECAG00000025044
VGNC: 15086
LinkDB
Position
4
AA seq 907 aa
MFGVFVRILAERSQRKSFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSF
LKAHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSANVVYTTPGTRVNRYISRLLEARQPELEMADL
NFFTLKYKQAERERKYHQLQDEYFTSAVVLALALAALFSLVYLLIIPQNLAVLLLLVFSI
CFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSSPNG
SLVFLSSGGRSPVLPAPPCESAPHALLCGLVGTLPLAIFLRVSSLPKMILLSVLTASYIL
VLELSGYTKAVGGGTVSGRSFEPIVAILLFSCTLALHARQVDVKLRLDYLWAVQAEEERD
DMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIEL
DGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGAKAKKCI
SSHLGTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVN
VASRMDSTGVQGRIQVTEEVHRLLRRGAYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQ
SRSLNSERKMYPYGRAGLQTRLATGHPPVPAVAGLPVTAGLGALQGSGIAPGPPGPPLPP
GAAGKEA
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgttcggcgtctttgtgaggatcctggccgagcgctcccagaggaagtccttcctgcag
gcccgaaactgcatcgaggaccggctgcgactggaggacgagaatgagaagcaggagcgg
ctgctcatgagtctcttgccccggaacgtcgccatggagatgaaggaggacttcctgaag
ccccccgagaggattttccacaagatttacatccagcggcatgacaacgtgagcatcctc
ttcgcagacatcgtgggcttcacgggcttggcgtctcagtgcacggcccaggagctggtg
aaactcctcaacgagctcttcggcaagtttgatgaattggccacggagaaccactgccgc
cgcatcaagatcctcggagactgttactactgcgtgtctggcctcacccagcccaagact
gaccacgcccattgctgtgtggagatgggcctggacatgatcgacaccatcacgtccgtg
gccgaggccaccgaggtggacctgaacatgcgtgtggggctgcacaccggcagggtcctc
tgcggggtcctgggcctgcgcaagtggcagtatgatgtgtggtccaacgacgtgaccttg
gccaatgtcatggaggccgccggcctgccggggaaggttcatatcacgaagaccaccctg
gcgtgcttgaatggcgactacgaggtggaaccaggtcacggacacgagaggaacagtttt
ctgaaagctcacaatatcgagaccttttttattgtgccatcgcatcggcgaaagatattt
ccggggctgattctctcagacataaagccggccaagaggatgaagttcaagaccgtgtgc
tacctgctggtgcagctcatgcactgccggaagatgttcaaggcggagatccccttctcc
aacgtcatgacctgcgaggatgatgacaagcggagggctttgagaacagcctcggaaaaa
ctcagaaaccgctcgtctttctctgcgaacgttgtgtacaccaccccgggcacgcgcgtc
aataggtacatcagccgcctcctagaagcccgccagccagaactggagatggcagacctg
aacttcttcaccctgaagtacaagcaagctgagcgagagcgaaagtaccaccagctccag
gacgagtacttcaccagcgccgtcgtgctcgccctcgccctggccgccttattcagcctc
gtctaccttctgatcatcccgcagaacttggctgtcctgctcctgctggtgttctccatc
tgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtccagtgttttccaggg
tgcctgacgatccagattcgtaccgtcctgtgtattttcatagtggtcttaatctattct
gtggcccaaggatgtgtggtgggctgtctgccctgggcctggagctccagtcccaacggg
tctctggtgttcctgtcgtccggcggccggagcccagtgctgcctgccccgccctgcgag
tctgcaccccacgccctgctctgtggcctggtgggcaccctcccgctggccatattcctg
cgggtctcttccttgcccaaaatgatcctgctctccgtgctcacggcgtcctacatcctg
gtcctggagctcagcgggtacaccaaggccgtggggggcggcactgtctctgggcgcagc
ttcgagccgattgtggccatcctgctgttctcgtgcacgctggccctgcacgcccggcag
gtggacgtcaagctgcggctggactacctctgggctgtgcaggcagaggaggagcgagac
gacatggagcgggtgaagctggacaataagaggattctcttcaatctcctgccggcccac
gtcgcccagcatttcctcatgtccaacccccggaacatggacctctactaccagtcgtac
tcgcaggtgggcgtcatgttcgcctccatccccaacttcaacgacttctacatcgagctg
gatggcaacaacatgggggtggagtgcctgcgcctcctgaacgagatcattgccgacttc
gacgagctcatggacaaagacttttacaaggacctggagaagatcaagaccattgggagc
acttatatggccgcggtgggattggcgcccacggctggggccaaggctaagaagtgtatc
tcctcccacctcggcacgctggcggattttgccatcgagatgttcgacgtcctggatgag
atcaactaccagtcttacaatgacttcgtgctccgtgtcggcatcaacgttggccccgtg
gtggctggggtgattggggctcgcaggccgcagtatgacatctggggaaacactgtcaac
gtggccagtcggatggacagcaccggggtccagggcagaatccaggtgacggaggaggtg
caccggctgctgcggcggggtgcgtaccgtttcgtgtgccgaggcaaagtcagtgtcaag
ggcaagggcgagatgctaacatacttcctggaaggcaggaccgacggaaatggctcccaa
tccaggtccctgaactcggagcggaaaatgtatccttacggcagagctggcctccagacc
agactggccacgggccacccccctgtgcccgccgtggctggcctcccggtcacagctggg
ctgggggctctgcagggctcggggatcgcccctgggcctcccggcccacccctgccccct
ggagcagctggaaaggaggcttag

KEGG   Equus caballus (horse): 100066046
Entry
100066046         CDS       T01058                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04962  Vasopressin-regulated water reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100066046 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100066046 (ADCY9)
   04371 Apelin signaling pathway
    100066046 (ADCY9)
   04020 Calcium signaling pathway
    100066046 (ADCY9)
   04072 Phospholipase D signaling pathway
    100066046 (ADCY9)
   04024 cAMP signaling pathway
    100066046 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100066046 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100066046 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100066046 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100066046 (ADCY9)
   04062 Chemokine signaling pathway
    100066046 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100066046 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100066046 (ADCY9)
   04912 GnRH signaling pathway
    100066046 (ADCY9)
   04913 Ovarian steroidogenesis
    100066046 (ADCY9)
   04915 Estrogen signaling pathway
    100066046 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100066046 (ADCY9)
   04921 Oxytocin signaling pathway
    100066046 (ADCY9)
   04926 Relaxin signaling pathway
    100066046 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    100066046 (ADCY9)
   04918 Thyroid hormone synthesis
    100066046 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100066046 (ADCY9)
   04916 Melanogenesis
    100066046 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100066046 (ADCY9)
   04927 Cortisol synthesis and secretion
    100066046 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100066046 (ADCY9)
   04270 Vascular smooth muscle contraction
    100066046 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100066046 (ADCY9)
   04971 Gastric acid secretion
    100066046 (ADCY9)
   04972 Pancreatic secretion
    100066046 (ADCY9)
   04976 Bile secretion
    100066046 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100066046 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100066046 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100066046 (ADCY9)
   04727 GABAergic synapse
    100066046 (ADCY9)
   04725 Cholinergic synapse
    100066046 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100066046 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100066046 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100066046 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100066046 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100066046 (ADCY9)
   04714 Thermogenesis
    100066046 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100066046 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100066046 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100066046 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100066046 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100066046 (ADCY9)
   05163 Human cytomegalovirus infection
    100066046 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100066046 (ADCY9)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100066046 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 Complex1_LYR_1 AC_N
Other DBs
NCBI-GeneID: 100066046
NCBI-ProteinID: XP_001502298
Ensembl: ENSECAG00000024355
VGNC: 15093
UniProt: F6XFB9
LinkDB
Position
13
AA seq 1353 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
AGVPRRVGVGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLIVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSSNHTRAAKSTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVAYSVLFETFGYHFRDEDCFPSPGAGALHWELLSRALLHVCVHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLIAGQRAKESRCSCSEALLSGFEVIDGSRLS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQEEHKN
STKASGGPNSKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERNYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAAAMPPPPAALAVFSTALLLEVLSLVVSVR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHITSEFETNIHFTVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYISLCPDSSIVMSHLDAVQNFSSQR
HPCNSSLLHDSRRPARLIGQEVALVFFLLLLLVWFLTREFEVSYRLHYHGDVEADLHRTT
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATRCQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDNGVVPHHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQNLDKTSLGSDNNTQAKDAHLSSKRPWKEPIKAEE
RCRFGKAIEKSDCEEMGMEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttctccgccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgac
tccagcggcgacagcaacagcgtgagggtcaaaatcaaccccaagcagctgtcctccaac
agccaccccaaacactgcaagtacagcatctcctccagctgtagcagctccggggactcg
gcgggggtcccccggagagtgggcgtcggaggccgcctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaagttcgactcggtgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacgcagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgccttctctggagcatctattttggggtccacatgagatcc
aaactgattgtcatggtcgcccctgctctgtgcttcctcgtggtgtgtgtgggctttttt
ctctttaccttcaccaagctgtatgcccggcattacgtgtggacctcgctggttctcacc
ctcctggtgttcgccctgaccctggctgcccagtttcaggttttgacgcctctctcagga
cgggttgacagctccaatcatacacgggcagccaagtccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgtttttgggagtggcgtattctgttctttttgagacctttggc
tatcatttccgagatgaagattgtttcccctcgcctggggcaggggccctgcactgggag
ctgctgagccgggccctgctccacgtctgcgttcacgccatcgggatccacctgttcatc
atgtcccaggtgagatccagaagcaccttcctcaaggtgggacagtcaattatgcacggg
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacctgatgaaacagggggatgaagagagcgagaattctgtcaaaagg
catgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaggcccctatt
gcattccgcccgtttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtctgctcacgccctggtgggtctcctcaat
gatctcttcggtcgcttcgaccggttatgtgaagagaccaagtgtgagaaaatcagcacc
ttgggggactgctactattgtgtggcagggtgccccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcttgggcatgataagagccattgagcagttctgccaggagaag
aaggagatggtgaacatgcgcgttggggttcacacggggaccgtgttgtgcggcatcttg
ggcatgaggaggtttaaatttgatgtgtggtccaatgacgtgaacttggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttctgaggccactgcaaaatacctagat
gatcggtacgaaatggaagatgggaaggttactgaacgcctcggccagagtgttgttgcc
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcgt
tgcagctgttcagaggccttgctttctggctttgaggtcattgacggctcacggctgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcatgcggaatcacgtttgctcccaaa
tcagaagctggtgcagaaggaggagcagtgcaaaatggctgtcaagaggagcataaaaac
agtaccaaggcttctggaggacctaattccaaaacgcaaaacggacttctgagccctccc
caggaagagaagctcaccaacagtcagacctccctgtgcgagatcttacaggaaaaggga
aggtgggcaggtgtgagcttggaccagtcagctctccttccactgagattcaagaacatc
cgggagaaaacagacgcccattttgttgatgttatcaaagaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcttgaacttcctggatcaggagctagag
cgaaactacaggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctcctggatgtgtttctgtccacgacagtgtttctgatt
ctctccatcacctgcttcctgaagtacggggccgccgccatgcctcccccgccggccgcc
ctggccgtcttcagcactgccctgctgttggaggtgctgtccctcgtggtctccgtcagg
atggtgtttttcctggaggatgtgatggcttgtaccaagcgcctgctagagtggatagcc
ggctggctcccgcgccatttcatcggggccatcctggtgtccctccctgctctcgcagtc
tattcacacatcacctctgaatttgagacaaacatacatttcaccgtgttcaccggctca
gctgctctcatcgccgtcgtgcactattgtaacttctgccagctcagctcctggatgagg
tcctccttggccaccgtcgtcggggcggggcccctgcttctgctctatatctccctctgt
ccggacagttccatagtaatgtcacaccttgatgcagtacagaatttcagttcccagagg
catccgtgcaatagttccttgctgcatgacagcaggagaccagcccgcctaattggccaa
gaggtggctcttgtcttctttctcctgctcttgttggtctggttcctgacccgagaattc
gaagtcagctaccgccttcactaccatggggacgtggaggcggaccttcaccgcaccacg
atccagagcatgagggaccaagccgactggctgctgaggaacatcatcccctaccacgtg
gccgagcagctgaaggtttcccagacctactccaagaaccatgacagcggaggagtcatc
ttcgccagcatcgtcaacttcagtgagttctacgaggagaactacgagggaggcaaggag
tgctaccgggtcctcaatgagctgatcggggacttcgacgagctcctgagcaagccagac
tacagcagcatcgagaagatcaagaccatcggggccacatacatggcggcgtcggggctg
aatgccacacggtgccaggacggtagccacccgcaggagcacctgcaaatcctgtttgag
tttgccaaggagatgatgcgcgtggtggacgatttcaacaacaacatgctctggttcaac
ttcaagctcagagttggcttcaaccatgggcccctcacagcaggggtcatcggcacgacc
aagctgctgtacgacatctggggggacaccgtcaacatcgccagcaggatggacaccacg
ggggtggagtgccgcatccaggtgagtgaagagagctaccgtgtcctaagcaagatgggc
tacgactttgactacagagggacggtgaacgtaaaggggaaaggtcagatgaagacctac
ctttacccaaagtgcatggacaacggggtcgtgccgcatcaccagctgtccatctcccca
gacatccgagtccaggtggacggcagcatcggacggtctcccacggacgagattgccaac
ctggtgccttctgtacagaacttggacaagacgtctctgggttctgataacaacacacag
gccaaggatgctcacctgtcctctaagagaccctggaaagagcccatcaaagccgaagaa
aggtgtcgatttggcaaagccatagagaagagcgactgtgaagaaatggggatggaagaa
gccaacgagctcaccaagctcaacgtctcaaagagtgtgtga

KEGG   Equus caballus (horse): 100070498
Entry
100070498         CDS       T01058                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100070498 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100070498 (ADCY5)
   04371 Apelin signaling pathway
    100070498 (ADCY5)
   04072 Phospholipase D signaling pathway
    100070498 (ADCY5)
   04024 cAMP signaling pathway
    100070498 (ADCY5)
   04022 cGMP-PKG signaling pathway
    100070498 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100070498 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100070498 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100070498 (ADCY5)
   04062 Chemokine signaling pathway
    100070498 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    100070498 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    100070498 (ADCY5)
   04912 GnRH signaling pathway
    100070498 (ADCY5)
   04913 Ovarian steroidogenesis
    100070498 (ADCY5)
   04915 Estrogen signaling pathway
    100070498 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    100070498 (ADCY5)
   04921 Oxytocin signaling pathway
    100070498 (ADCY5)
   04926 Relaxin signaling pathway
    100070498 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    100070498 (ADCY5)
   04918 Thyroid hormone synthesis
    100070498 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    100070498 (ADCY5)
   04916 Melanogenesis
    100070498 (ADCY5)
   04924 Renin secretion
    100070498 (ADCY5)
   04925 Aldosterone synthesis and secretion
    100070498 (ADCY5)
   04927 Cortisol synthesis and secretion
    100070498 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100070498 (ADCY5)
   04270 Vascular smooth muscle contraction
    100070498 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    100070498 (ADCY5)
   04971 Gastric acid secretion
    100070498 (ADCY5)
   04972 Pancreatic secretion
    100070498 (ADCY5)
   04976 Bile secretion
    100070498 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100070498 (ADCY5)
   04727 GABAergic synapse
    100070498 (ADCY5)
   04725 Cholinergic synapse
    100070498 (ADCY5)
   04728 Dopaminergic synapse
    100070498 (ADCY5)
   04726 Serotonergic synapse
    100070498 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    100070498 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100070498 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    100070498 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    100070498 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100070498 (ADCY5)
   04714 Thermogenesis
    100070498 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070498 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100070498 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    100070498 (ADCY5)
   05031 Amphetamine addiction
    100070498 (ADCY5)
   05032 Morphine addiction
    100070498 (ADCY5)
   05034 Alcoholism
    100070498 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100070498 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100070498 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100070498 (ADCY5)
   05163 Human cytomegalovirus infection
    100070498 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100070498 (ADCY5)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100070498 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 100070498
NCBI-ProteinID: XP_001917101
Ensembl: ENSECAG00000009948
VGNC: 15090
LinkDB
Position
19
AA seq 1259 aa
MSSSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSARSSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLVGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAAGGGSTRAPPAGGGGGSAAAAAAAGGREVRPRSVELGLEERRGKGRAADELEAGAVEG
DEGSGDGGSSAGSDAGPGPVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQSSL
TMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMGLAC
YALIAVVLAVQVVGLLMPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHL
AIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQ
RENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLA
SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGM
DMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAG
RIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQ
RTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGR
AIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQVTI
VPHSVFMLSFYLTCFLLLTLAVFVSVIYSCVKLFPVPLQTLSRKIVRSKMNSTLLGVFSI
ILVFLSAFVNMFMCNSRDLFSCLAEEHNISASQVNACHVVESAVNYSLGDEQGFCGSPWP
NCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADLLV
TANAIEFNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQA
TEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSE
FYVELEANNEGVECLRLLNEIIADFDEIISEDRFKQLEKIKTIGSTYMAASGLNDSTYDK
VGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNT
VNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
NT seq 3780 nt   +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacaccgctccgcgtggggggaggccgattcccgcgccaat
ggctacccccacgcccccgggggttcggcccgcagctccaccaagaaacccgggggggcg
gtgaccccgcaacagcagcagcgcctggccagccgctggcgcagcgacgacgatgacgat
cctccgctgagtggcgacgaccccctggtcgggggcttcggcttcagcttccgctccaag
tcagcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcagcggcgg
ggcgcggccggcgggggcagcacccgggcgccccctgcgggcggcggcggcggctcggcg
gccgcggcggccgcagcgggcgggagggaggtgcgcccccgctcggtggagctgggcctg
gaggagcggcggggcaagggccgcgcggccgacgagctggaggccggcgccgtcgagggc
gatgagggctccggggatggcggcagctcggcgggctcggacgcgggtcccggcccggtg
ctgtcgctgggcgcctgctgcctggcgctgctgcagatattccgctccaagaagttcccg
tcggacaagctggagcggctgtaccagcgctactttttccgtctgaaccagagcagcctc
accatgctcatggccgtgctggtgctcgtgtgcctcgtcatgttggccttccacgcggcg
cggcccccgctccagctgccctacctggccgtgctggcggccgccgtgggcgtgatcctg
gtcatggcggtgctctgcaaccgcgccgccttccaccaggaccacatgggcctggcctgc
tacgcgctcatcgccgtggtgctggccgtccaggtggtgggcctgctgatgccccagccg
cgcagcgcctccgagggcatctggtggaccgtgttcttcatctacaccatctacacgctg
ctgcctgtgcgcatgcgggccgcggtactaagcggggtgctcctgtctgccctgcatctg
gccattgccctgcgcaccaacgcccaggaccagttcctgctcaagcagcttgtctccaat
gtcctcattttctcctgcaccaacatcgtgggtgtctgcacccactacccggccgaggtc
tcccagagacaggccttccaggagacccgggagtgcatccaggcgcggctccactcacag
cgggagaaccagcagcaggagcggcttctgctgtctgtccttccccgtcatgttgccatg
gagatgaaagcagacatcaatgccaaacaggaggatatgatgttccacaagatttacatc
cagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcaccagcctggcg
tcccagtgcactgcccaggagctggtcatgaccctcaacgagctcttcgcccgcttcgac
aagctggccgcggagaaccactgtttacgtattaagatcctgggggattgttattactgt
gtttcggggctgcctgaagcgagggctgaccatgcccactgctgcgtggagatgggcatg
gacatgattgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaacatgcgc
gtgggaatccacagcgggcgagtacactgcggtgtccttggtctcaggaagtggcagttc
gacgtctggtctaacgacgtcacgctagccaaccacatggaggctggaggcaaggcggga
cgcatccacatcaccaaggccacactcaactacctgaacggtgactacgaggtggagcca
ggctgtgggggcgagcgcaacgcctacctcaaggagcacagcatcgagaccttcctcatc
ctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatgaatcgccag
agaaccaattccatcgggcacaacccgccacactggggggccgaacgccccttctacaac
cacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaagaccccaag
gacaagaacgcccaggaaagtgcaaaccctgaggatgaagtggacgaatttctgggccgt
gccattgacgccaggagcatcgacaggctgcgatctgagcatgtccgcaagttcctcttg
actttcagggaacctgacttagagaagaagtactccaagcaggtggatgaccgattcggt
gcctacgtggcgtgtgcctcgctggtcttcctcttcatctgctttgtccaggtcaccatc
gtgccccactccgtgttcatgttgagtttctacctgacgtgtttcctgctgctgaccttg
gcggtgtttgtgtccgtgatctactcctgcgtgaagctcttcccggtgcccctgcagacc
ctgtccaggaaaatcgtgcggtccaagatgaacagcaccctgctcggggtgttcagcatc
atcctggtgttcctgtcggcttttgtcaacatgttcatgtgcaactccagggacctgttc
agctgcctggcggaggagcacaacatcagtgccagccaggtcaacgcgtgccacgtggtg
gagtccgccgtcaactacagcctgggcgatgaacagggcttctgcggcagcccctggccc
aactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctggcctgctcc
gtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctcatc
tacgtgctcatcgtcgaggtgcccggtgtcacactctttgacaatgccgacctgctggtc
accgccaacgccatcgagttcaacaacaacgggacctcccagtgccctgagcatgccacc
aaggtggcgctgaaggtggtgacgcccatcatcatctcagtcttcgtgctggccctgtac
ctgcacgcccagcaggtggagtccaccgcccgccttgacttcctctggaaactgcaggcc
acagaggagaaggaggagatggaagagctgcaggcctacaaccgccggctgctgcacaac
atcctgcccaaggacgtggccgcccacttcctggcccgcgagcggcgcaacgatgagctg
tactatcagtcgtgcgagtgcgtggccgtcatgttcgcctccatcgccaacttctccgag
ttctacgtggagctggaggccaacaacgagggcgtcgagtgcctgcggctgctcaacgag
atcatcgccgactttgatgagatcatcagcgaggatcggttcaagcagctggaaaagatc
aagaccatcggcagcacctacatggccgcctcgggcctcaacgactccacctacgacaaa
gtgggcaagacccacatcaaggctctggccgacttcgccatgaagctgatggaccagatg
aagtacatcaacgagcactccttcaacaacttccagatgaagatcgggctcaatatcggc
cccgtggtggctggggtgatcggggcccgcaagcctcagtatgacatctggggcaatacg
gtgaatgtggccagccgcatggacagcaccggtgtgcccgaccgcatccaggtcaccaca
gacatgtaccaggtgctggccgccaacacttaccagctggagtgccggggtgtggtcaag
gtcaagggcaaaggcgagatgatgacctacttcctcaatggagggcccccgctcagttag

KEGG   Equus caballus (horse): 100071337
Entry
100071337         CDS       T01058                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2 isoform X1
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb01522  Endocrine resistance
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04727  GABAergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04976  Bile secretion
ecb05032  Morphine addiction
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100071337 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100071337 (ADCY2)
   04371 Apelin signaling pathway
    100071337 (ADCY2)
   04020 Calcium signaling pathway
    100071337 (ADCY2)
   04072 Phospholipase D signaling pathway
    100071337 (ADCY2)
   04024 cAMP signaling pathway
    100071337 (ADCY2)
   04022 cGMP-PKG signaling pathway
    100071337 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100071337 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100071337 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100071337 (ADCY2)
   04062 Chemokine signaling pathway
    100071337 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    100071337 (ADCY2)
   04922 Glucagon signaling pathway
    100071337 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    100071337 (ADCY2)
   04912 GnRH signaling pathway
    100071337 (ADCY2)
   04913 Ovarian steroidogenesis
    100071337 (ADCY2)
   04915 Estrogen signaling pathway
    100071337 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    100071337 (ADCY2)
   04921 Oxytocin signaling pathway
    100071337 (ADCY2)
   04926 Relaxin signaling pathway
    100071337 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    100071337 (ADCY2)
   04918 Thyroid hormone synthesis
    100071337 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    100071337 (ADCY2)
   04916 Melanogenesis
    100071337 (ADCY2)
   04925 Aldosterone synthesis and secretion
    100071337 (ADCY2)
   04927 Cortisol synthesis and secretion
    100071337 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100071337 (ADCY2)
   04270 Vascular smooth muscle contraction
    100071337 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    100071337 (ADCY2)
   04971 Gastric acid secretion
    100071337 (ADCY2)
   04972 Pancreatic secretion
    100071337 (ADCY2)
   04976 Bile secretion
    100071337 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100071337 (ADCY2)
   04727 GABAergic synapse
    100071337 (ADCY2)
   04725 Cholinergic synapse
    100071337 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    100071337 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100071337 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    100071337 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    100071337 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100071337 (ADCY2)
   04714 Thermogenesis
    100071337 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100071337 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    100071337 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100071337 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100071337 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100071337 (ADCY2)
   05163 Human cytomegalovirus infection
    100071337 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100071337 (ADCY2)
Enzymes [BR:ecb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100071337 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 100071337
NCBI-ProteinID: XP_023481630
Ensembl: ENSECAG00000016266
VGNC: 15087
LinkDB
Position
21
AA seq 1095 aa
MWQEAMRRRRYLRDRAEAAAAAAAGGGDGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMG
ACLALLAVFFALRLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWMC
LVAMGYLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVC
LSATPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFE
KRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADI
VGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAK
NCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHM
EAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHL
FRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQ
NRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATA
LPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLSLAFILFVCFAGQLLQCSK
KASASLLWLLKSSGIIANRPWPRICLTVVTTAIILTMAVFNMFFLSDSEETIPATANISN
TSLSASSNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMAALVGYNTI
LLHTHAHVLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLWKN
KFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDF
KEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPS
QEHAQEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTYFV
NTEMSRSLSQSNLAS
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggcggcggcg
gcggcagcggcgggcggcggcgacgggctgcagcggtcccgggactggctctatgagtcc
tactactgcatgagccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggc
gcctgcctcgccctgctcgccgtcttcttcgcgctccggctggaagttgaagaccacgtg
gcgtttttaataacagttcccactgccctggcgatcttctttgcgatattcatcctggtc
tgcatcgagtctgtgtttaagaagctgctccgcgtcttctcattggtgatatggatgtgt
ctcgtggccatggggtacttgttcatgtgttttggaggtaccgtctctgcctgggatcag
gtatcattcttcctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgaga
gatgccatcattgccagtgtgctcacctcctcctcccacaccatcgtgctgagcgtctgc
ctgtctgcaacacccggggccaaggagcacctagtctggcagatcctggccaacgtgatc
attttcatctgtgggaacctggctggagcataccataagcacctcatggagctcgcgctg
cagcaaacatatcaggacacgtgcaattgcataaagtcccggatcaagttagaatttgaa
aagcgtcagcaggagcggctcctgctgtccctgctgccggctcacatagccatggagatg
aaggccgagatcatccagaggctgcagggccccaaagccggccaaatggaaaacacaaac
aactttcacaacctgtacgtcaagcggcacaccaacgtcagtatcctctacgctgacatt
gttggcttcacccggctggccagcgactgctcccccggagaactagtgcacatgctgaat
gaactcttcggaaagttcgatcaaattgcaaaggagaatgaatgcatgagaataaaaatt
ttaggagactgctactactgtgtgtctggactccctatatctctccctaaccacgccaaa
aactgtgtgaaaatggggctggatatgtgtgaagccataaagaaagtgagggatgccact
ggagttgatatcaacatgcgcgtgggagtgcattctgggaacgtcctctgcggtgtgatt
ggtctgcagaagtggcagtacgatgtgtggtcacatgatgttaccttggccaaccacatg
gaagctggaggggtccctggacgtgttcacatttcttcagtcaccctggagcacttgaat
ggggcttataaagtggaggaaggagatggtgacatcagggacccatatttaaaacagcac
ctggtgaaaacctactttgtaatcaaccccaagggagaacgacggagtccccagcacctc
ttcagacctcgccacaccctcgatggagccaagatgagggcctccgtccgcatgacccgg
tacctggaatcctggggggcggccaagccgtttgctcacctgcatcacagagacagcatg
accacggagaacggcaagatcagcaccacggatgtaccaatgggtcagcataattttcaa
aatcgcacattaagaaccaagtcacaaaagaaaaggtttgaagaggaactaaatgaaagg
atgattcaagcaattgatggaattaatgcacaaaagcaatggctcaagtctgaagatatt
cagagaatctcattgcttttctacaataaaatactagaaaaagaataccgagccactgca
ctgccggcattcaagtactacgtgacttgcgcttgtctcatattcttctgcatctttatt
gtgcagattctggtattaccaaaaacgtccgttctcgggatttcctttggagctgcattt
ctctcgcttgcctttatccttttcgtctgctttgctggacagcttttgcaatgcagcaaa
aaggcctctgcctctctcctatggcttctgaagtcatctggcatcatcgcgaaccgcccc
tggccgcggatctgcctcacggtcgtcaccacggccatcatattaaccatggccgtgttc
aacatgtttttcctgagtgactcagaggagaccatccctgcaactgccaatatatcaaac
acaagtctttctgcctcaagtaatcaggcagcgattctgcgtgcgcaaaatttgtttttc
cttccgtactttatctacagctgcattctgggattgatctcctgttcggttttcctgcgg
gtgaattatgagttgaaaatgttgatcatgatggccgcattggtgggctacaataccatc
ctccttcacactcacgcccacgtcctggatgactacagccaggtcttattcgagagacca
ggcatttggaaagacctaaagaccatgggttcagtgtctctctttatattcttcatcaca
ctgcttgttctggggagacagaatgaatattactgtaggttagacttcttatggaagaac
aagttcaaaaaagagcgggaggagatagaaaccatggagaacctgaaccgcgtgctgctg
gagaacgtgcttcccgcgcacgtggccgagcatttcctggcccggagtctgaagaatgag
gacttataccaccagtcctatgactgtgtctgcgtcatgtttgcctccatcccggatttc
aaagaattctatacggaatcagatgtgaacaaggagggcctggaatgccttcggctcctg
aacgagatcatcgctgactttgatgatctgctgtccaagccaaagttcagtggagttgaa
aagatcaagaccatcggcagcacatacatggctgcgacggggctgagcgccgtgcccagc
caggagcacgcccaggagcccgagaggcagtacatgcacataggcaccatggtggagttc
gcctttgcgctggtggccaaactggacgccatcaacaagcactccttcaacgacttcaag
ttgcgagtgggtattaatcatggacctgtaatagctggtgtaattggagctcagaagcca
caatatgatatctggggcaacactgtaaatgtggccagtaggatggatagcaccggagtt
ctggacaaaatacaggttactgaggagacgagcctcattctgcagaccctgggatacacg
tgcacatgtcgaggaataatcaacgtgaaaggaaagggggaactgaagacatactttgta
aacacagaaatgtcgaggtccctctcccagagcaacctggcttcctga

DBGET integrated database retrieval system