KEGG   Equus caballus (horse): 100051333Help
Entry
100051333         CDS       T01058                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04062  Chemokine signaling pathway
ecb04140  Autophagy - animal
ecb04270  Vascular smooth muscle contraction
ecb04621  NOD-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04722  Neurotrophin signaling pathway
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100051333 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100051333 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    100051333 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    100051333 (PRKCD)
   04062 Chemokine signaling pathway
    100051333 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100051333 (PRKCD)
   04915 Estrogen signaling pathway
    100051333 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100051333 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100051333 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051333 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100051333 (PRKCD)
   04931 Insulin resistance
    100051333 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051333 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100051333 (PRKCD)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100051333 (PRKCD)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100051333 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like zf-RING-like C1_2 Zf_RING Pkinase_fungal Haspin_kinase PHD zf-RING_9 DUF2318 APH DZR FYVE_2
Motif
Other DBs
NCBI-GeneID: 100051333
NCBI-ProteinID: XP_023476050
Ensembl: ENSECAG00000023172
VGNC: 21844
LinkDB All DBs
Position
16
AA seq 703 aa AA seqDB search
MAPFLRIAFNSYELGSLQAEDEASQPFCAVKMKEALSTDRGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDIDCKQSVRAEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFRQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALNQVSQRPTR
KSESGPPEHFGIYQNFEKKPGVSGDDAPGEAKAHFSQESPISPQGLRMEPSLPPLSNHST
YGKIWEGSNRCNIENFTFHKVLGKGSFGKVLLAELKGKKEFFAIKALKKDVVLIDDDVEC
TMVEKRVLALAWENPFLTHLLCTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFY
AAEIICGLQFLHNKGIIYRDLKLDNVMLDQDGHIKIADFGMCKENIFGEKQASTFCGTPD
YIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRMDTPHYPRWITK
ESKDILEKLLERDPTKRLGVTGNIKAHSFFKTINWTLLEKRAVEPPFKPKVKSPGDYSNF
DQEFLNEKPRLSYSDKNLIDSMDQAAFAGFSFVNPKFERLLEK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgttcctgcgcattgccttcaactcctacgagctgggctccctgcaggctgag
gatgaggcaagccaacccttctgtgccgtgaagatgaaggaggcgctcagcacagaccgt
gggaagacgctggtgcagaagaagcccaccatgtatcctgagtggaagtcgacgttcgat
gcccacatctacgagggccgcgtcatccagattgtgctgatgcgggccgccgaggagccg
gtgtccgaggtgaccgtgggcgtgtcagtgctggccgagcgctgcaagaagaacaatggc
aaggccgagttctggctggacctgcaaccccaggccaaagtattgatgtctgtgcagtat
ttcctggaagacatagattgcaagcagtctgttcgggctgaagacgaggccaagttccca
acaatgaaccgccgtggagccatcaaacaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttaggcagcccaccttctgttctgtgtgcaaagactttgtctgg
ggtctcaacaagcaaggctacaaatgcaggcaatgcaatgctgccatccacaagaaatgc
atcgacaagatcatcggtcggtgcactggcaccgcggccaacagccgggacaccatattc
cagaaagaacgtttcaacattgacatgccgcaccggttcaaggtttacaactacatgagc
cccaccttctgtgaccattgtggcagcctgctctgggggctggtgaagcagggattaaag
tgtgaagactgtggcatgaacgtgcaccataagtgccagaagaaggtggccaacctctgc
ggcatcaaccagaagctcttggctgaggcactgaaccaagtcagccagagacccacccgg
aagtcggagtctgggcctccggagcatttcgggatctaccagaattttgagaagaagcca
ggagtctctggagatgatgccccaggtgaagctaaggcccatttctcccaggaaagccct
atctccccacaggggctcaggatggagcctagcctccctccactgtcaaaccacagtacc
tacggcaagatctgggagggcagcaacagatgcaacattgagaacttcaccttccacaag
gtcctgggcaaaggcagcttcgggaaggtgctgcttgcagagctgaagggcaaaaaggag
ttcttcgccatcaaggccctcaagaaggatgtggttctgattgatgatgacgtggagtgt
accatggtggagaagcgggtgttggcgctcgcctgggagaatccctttctcacccacctc
ttatgtacattccagaccaaggaccacctgttcttcgtgatggagttcctcaacggggga
gacctgatgtaccacatccaggataaaggccgctttgaactctaccgtgccacgttttat
gcagctgagataatctgtggactacagtttctacacaacaaggggatcatttacagggac
ctcaagctggacaatgtgatgctggaccaggatggccacatcaagattgccgactttggg
atgtgcaaggagaacatattcggggagaaacaggccagcaccttctgcggcacccctgac
tatatcgcccccgagatcctgcagggcctgaagtactcgttctccgtggactggtggtcc
tttggagtccttctctatgagatgctcattggtcagtcccccttccacggtgacgatgag
gatgaactcttcgagtccatccgtatggacacaccacattatccccgctggatcaccaag
gagtccaaggacattctggagaagctgcttgaaagggatccaaccaagaggctgggagtg
acagggaacatcaaagcccactccttcttcaagaccatcaactggacgctgctggagaaa
cgtgcggtggagccgcccttcaagcccaaagtgaagtcccctggagactacagcaacttc
gaccaggagttcctgaacgagaagccacgcctctcctacagcgacaagaacctcattgac
tccatggaccaagcagcctttgctggcttctccttcgtgaaccccaaatttgagaggctc
ctggaaaagtga

DBGET integrated database retrieval system