KEGG   Equus caballus (horse): 100051415
Entry
100051415         CDS       T01058                                 

Gene name
PAK5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04660  T cell receptor signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05170  Human immunodeficiency virus 1 infection
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100051415 (PAK5)
   04014 Ras signaling pathway
    100051415 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100051415 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100051415 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100051415 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    100051415 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100051415 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100051415 (PAK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100051415 (PAK5)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100051415 (PAK5)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100051415 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100051415
NCBI-ProteinID: XP_014590517
Ensembl: ENSECAG00000020220
VGNC: 51584
LinkDB
Position
22
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGQGHR
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPFYKGSPATKQNGHVMKMKHGEA
YYSEIKPLKSDIARFPVDYHAHLDSLSKPSEYSDLKWEYQRASSSPPLDYPFQFTPSRTA
GTGGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPAMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYSSYTYPRLSEPTVCIPKVDYDRAQMVLSPPLSGSDTYPRVPAKLPQS
QSKAGYSSSSHQYPSGYHKATLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVSDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttggaaagaaaaagaaaaagattgaaatatctggcccatctaactttgaacacagg
gttcatactgggtttgatccacaagaacagaaattcaccggcctcccccagcagtggcac
agcctgttggcagacacagccaacaggccgaagcccatggtggacccttcatgcatcaca
cccatccagctggctcccatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctggaagactttgacaacatctcggtaactcgctccaactcccta
aggaaagaaagcccgcccaccccggaccagggagcctccagccatggtcaaggccatcgg
gaagaaaatggcttcatcaccttctcacagtattccagcgaatctgataccactgctgat
tacacgaccgaaaagtacagagaaaagagtctctatggagacgatttggatccgttttat
aaaggcagccctgcaaccaagcaaaatgggcacgtaatgaaaatgaaacacggggaggcc
tactattctgagataaagcctttgaaatccgacattgccagatttcctgtcgattatcac
gcacatttggactcactgagcaaaccaagtgaatacagtgacctcaagtgggagtaccag
agagcctctagcagcccgcctctagattatccattccaattcacaccttctagaactgca
gggactggcgggtgctccaaggagagtctggcgtacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcgtcgtacctgaatcagacgagccctcagccc
gccatgcggcagaggtccaggtcaggctcggggctccaggaaccgatgatgcccttcgga
gcaagtgcatttaaaacccacccccaaggacactcgtacagttcctacacctaccctcgc
ttgtccgagcccacagtgtgcattccaaaggtggattacgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccagggtccccgccaaactacctcaaagt
caaagcaaagctggctattcctcaagcagccaccagtacccatctgggtaccacaaagcc
accctgtaccaccacccctccctgcagaccagttcgcagtacatctccacagcttcttac
ctgagctctctcagcatctcatccagcacctaccccccacccagctggggctcctcctca
gaccagcagccctccagggtgtcccacgaacagtttcgggctgctctgcagctggtggtc
agcccaggagaccctagggaatacttggacaactttatcaaaatcggagaagggtcaacc
ggcattgtgtgcatcgcaaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccgaaagcaacagagacgagaactgctcttcaatgaggttgtgataatgcgggat
taccaccatgacaatgtggttgacatgtacaacagctaccttgtcagtgatgagctctgg
gtggtcatggagtttctagaaggcggtgccttgacagacatcgttactcataccagaatg
aatgaagaacagatagctaccgtctgtctgtcggttctgagagctctctcctaccttcac
aatcaaggagtgattcacagggacataaagagtgactccatcctgctgacgagcgatggc
cggataaagctgtctgactttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcgttggttggcactccctactggatggcacccgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgatagaaatgatcgatggcgag
cccccctacttcaacgagcctcccctccaggcgatgcggaggatccgggacagtttacct
ccaagggtgaaggacctacacaaggtttcttcagtgctccggggattcctagacctgatg
ttggtgagggagccttcccaaagagccacagcccaggaactcctcggacatcccttcttg
aaactagcaggtccaccatcttgcatcgttcccctcatgagacaatacaggcatcactga

KEGG   Equus caballus (horse): 100054315
Entry
100054315         CDS       T01058                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04660  T cell receptor signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05132  Salmonella infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100054315 (PAK3)
   04014 Ras signaling pathway
    100054315 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100054315 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100054315 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100054315 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    100054315 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100054315 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100054315 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100054315 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100054315 (PAK3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100054315 (PAK3)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100054315 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N DSHCT APH Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 100054315
NCBI-ProteinID: XP_014584574
Ensembl: ENSECAG00000015727
UniProt: F7DUQ5
LinkDB
Position
X
AA seq 544 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEE
EEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIK
NSSR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccagctcccccactgaggatgaatagt
aacaaccgggattcttcagctctcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagaacgcccagagatctctcttccttcagactttgaacatacgatt
catgtggggtttgatgcagtcaccggggaattcactggaattcctgagcaatgggcacga
ttactccaaacctcaaacataacaaaactggaacagaagaagaacccacaagccgttcta
gatgttctcaaattctatgactccaaagaaacagtcaacaaccagaaatacatgagcttt
acatcaggagataaaagtgcgcatggatacatagcagcccatccttcgagtacaaaaaca
gcatcagagcctcctttggctccccctgtgtctgaagaagaagatgaagaagaggaagaa
gaagaagatgacaatgagccccccccagttattgcaccaagaccagagcatacaaaatca
atctacactcgttctgtggttgaatcgattgcttcaccagcagcaccaaataaagaggtc
acaccaccttctgctgagaatgccaattccagtactttgtatagaaatacagaccggcaa
aggaaaaaatccaagatgacagatgaggaaatcctagagaagctaagaagcattgtgagt
gttggtgacccaaagaagaaatacacaagatttgaaaaaattggtcaaggggcatcaggt
actgtttatacagcgctagacattgcaacaggacaagaggtggccataaagcagatgaac
cttcagcagcagcccaaaaaggaattaattattaatgaaattctggtcatgagggaaaat
aagaaccccaatattgttaattatttagatagctacttagtgggtgatgaactatgggta
gtcatggaatacttggctggtggctctttgactgatgtggtcacagagacctgtatggat
gaaggacagatagcagctgtctgcagagagtgcctccaagctttggatttcttgcactca
aaccaagtgatccatagagacataaaaagtgacaatattctccttgggatggatggctct
gttaaattgactgattttgggttctgcgctcagatcacccctgagcaaagtaaacgaagc
actatggtgggaactccctattggatggcacctgaggtggtgactagaaaagcttatggt
ccgaaagttgatatctggtctctggggattatggcaatcgaaatggtggaaggtgaacct
ccttaccttaatgaaaatccactcagggcattatatctgatagccactaatggaacccca
gagctccagaatcctgaaagactgtcggctgtattccgtgactttttaaatcgctgtctt
gagatggatgtggataggcgaggatctgccaaggagcttttgcagcatccatttttaaaa
ttagccaagcctctctccagcctgactcctctgattatcgctgcaaaggaagcaattaag
aacagcagccgttag

KEGG   Equus caballus (horse): 100060183
Entry
100060183         CDS       T01058                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04660  T cell receptor signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05170  Human immunodeficiency virus 1 infection
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100060183 (PAK2)
   04012 ErbB signaling pathway
    100060183 (PAK2)
   04014 Ras signaling pathway
    100060183 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100060183 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100060183 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100060183 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    100060183 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100060183 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100060183 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100060183 (PAK2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100060183 (PAK2)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100060183 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100060183
NCBI-ProteinID: XP_023479329
Ensembl: ENSECAG00000020281
LinkDB
Position
19
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTASKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETPAVVTEEDDDDEEAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGESSVDGGPKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLMGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccggcgcctcccgtgcgaatgagcagc
accatttttagcactgcaagcaaagatcctttgtcagctaatcacagtttgaaacctttg
ccctctgttccagaggagaaaaagcccaggaataaaatcatctctatcttctcaggcaca
gaaaaaggaagtaagaagaaagagaaggaacggccagaaatttctcctccatctgatttt
gagcacactatccatgttggctttgatgctgttactggagaattcacaggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcttaaagttctatgactccaacacagtgaaacagaaatacctg
agctttactcctcctgagaaggatggcttcccttctggaacaccagcactgaataccaag
ggatcagagacaccagcagtagtaacagaggaggacgatgatgatgaagaggctgctccc
cctgttattgccccacgaccggatcatacaaaatcaatttatacacggtctgtaatagac
cctattcctgcaccagttggtgaatctagtgttgatggtggtcctaagtcttctgacaaa
cagaaaaagaagaccaaaatgacagatgaagagattatggagaaattaagaactatcgtg
agcataggtgaccctaagaaaaaatatacaagatatgagaaaattgggcaaggggcttct
ggtacagttttcactgctaccgatgtggcattggggcaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtaatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctgatgggagatgaattgttt
gtggtgatggaataccttgctgggggatcgcttactgatgttgtaacagaaacctgcatg
gacgaagcacagatcgctgccgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacataaaaagtgacaatgtgctattggggatggaagga
tcagttaaacttactgactttggtttctgcgcccagatcacccctgagcagagcaagcga
agtaccatggttggaacgccatactggatggcaccagaggtggtcacacggaaggcttat
ggccctaaagtggacatatggtctctgggtatcatggctattgagatggtggaaggagag
cctccttacctcaacgaaaatcccttgagggcattgtatctgatagcaactaatggaacc
ccagaacttcagaatccagagaagctttctccaatatttcgggatttcttaaatcgatgt
ttggagatggatgtggagaaaagaggttcagccaaagaattgttacagcatcccttcctg
aaactggccaaaccattgtctagcttgacgccgctgatcatggcagccaaagaagcgatg
aagagtaaccgttag

KEGG   Equus caballus (horse): 100063217
Entry
100063217         CDS       T01058                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04360  Axon guidance
ecb04392  Hippo signaling pathway - multiple species
ecb04510  Focal adhesion
ecb04625  C-type lectin receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04810  Regulation of actin cytoskeleton
ecb05132  Salmonella infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100063217 (PAK1)
   04012 ErbB signaling pathway
    100063217 (PAK1)
   04014 Ras signaling pathway
    100063217 (PAK1)
   04392 Hippo signaling pathway - multiple species
    100063217 (PAK1)
   04024 cAMP signaling pathway
    100063217 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100063217 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100063217 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100063217 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    100063217 (PAK1)
   04660 T cell receptor signaling pathway
    100063217 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    100063217 (PAK1)
   04062 Chemokine signaling pathway
    100063217 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    100063217 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100063217 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100063217 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100063217 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100063217 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100063217 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100063217 (PAK1)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100063217 (PAK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100063217 (PAK1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100063217 (PAK1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100063217 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    100063217 (PAK1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100063217 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 100063217
NCBI-ProteinID: XP_001917210
Ensembl: ENSECAG00000017840
UniProt: F7AM77
LinkDB
Position
7
AA seq 544 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILA
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPITPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSGIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNSH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcttagacattcaagacaaacctccagcccctccgatgagaaacacc
agcactatgattggagccggcagcaaagatgctggaaccctaaaccacggttccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccatcttagct
ggagataaaacaaataaaaagaaggagaaggaacggccagagatttctcttccttcggat
tttgagcacacgattcacgttggttttgatgctgtcacaggggaatttacagggatgcca
gagcagtgggcccgtttgcttcagacgtcaaatatcactaagtcggagcagaagaaaaac
ccacaggctgttctggatgtactggaattttataactcaaagaagacttccaacagccag
aagtacatgagctttacagataaatcagctgaggattataattcttctaacactttgaat
gtgaagacggtgtctgagacccctgcagtgccaccagtttcagaagatgaagatgatgat
gatgacgctaccccgcctccagtgattgctccacgcccagagcacacgaaatcggtatac
acacggtctgtgatcgaaccacttcctattacaccaactcgggatgtggctacatctccc
atttcacctactgagaataataccactccaccggatgctctgacccggaacactgagaag
caaaagaagaaaccgaaaatgtctgatgaagagatcttggagaaattacggagcatagtg
agtgtgggcgatcctaagaagaagtatacacggtttgagaagattggacaaggtgcttca
ggcactgtgtacactgcaatggatgtggccacaggacaggaggtggccattaagcagatg
aaccttcagcagcagccgaagaaagagctgattattaatgagatcctggtcatgagggaa
aacaagaatccaaatattgtgaactacttggacagttacctcgtaggagatgagctgtgg
gttgtcatggaatacttggctggaggctctttgacagacgtggtgacagaaacctgcatg
gatgaaggccagattgcagctgtgtgccgtgagtgcctgcaggctttggagtttctgcat
tcaaaccaggtcattcacagagacatcaagagtgacaacatcctgttgggaatggatggc
tctgtcaagctaactgattttggattctgtgcccagatcaccccagagcagagcaaacgg
agcaccatggtgggaaccccatactggatggcgccagaggttgtgacgcggaaggcctat
gggcccaaggttgacatctggtccctgggcatcatggccattgaaatgattgaaggggaa
cccccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatgggacc
ccggagcttcagaacccagagaagctgtcaggtatcttccgggactttctgaaccgctgt
cttgagatggatgtggagaagagaggttcagctaaagagctgctgcagcatcagttcttg
aagattgccaagcccctctccagcctcactccactgattgctgcagcaaaggaggcaacc
aagaacagtcactaa

KEGG   Equus caballus (horse): 100067000
Entry
100067000         CDS       T01058                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4 isoform X1
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04660  T cell receptor signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05170  Human immunodeficiency virus 1 infection
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100067000 (PAK4)
   04014 Ras signaling pathway
    100067000 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100067000 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100067000 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100067000 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    100067000 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100067000 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100067000 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100067000 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100067000 (PAK4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100067000 (PAK4)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100067000 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 100067000
NCBI-ProteinID: XP_023505463
LinkDB
Position
10
AA seq 588 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPGCIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPTRARQQNGMPVE
QATTAGGGPERAGHGRVAGRSEGGGGSGDRRRAGPEKRPKSSREGSGAPQESSRDKRPLS
GPDVSAPQPAGLASGAKVAAGRPFNTYPRADTDHPSRGTQGDPHNLAPNGPSAGSLAVPQ
SSSRPPARARGPPSPGVLGPHASEPQLAPAARTLAAPAAAPGPPGPRSPQREPQRVSHEQ
FRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGRLVAVKKMDLRKQQRRELL
FNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLA
VLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMA
PELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSP
SLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtttgggaagaagaagaagcgggtggagatctcggcgccgtccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctcatcgaggagtcggcccgccggcccaagcccctcgtcgaccctggctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggcgccaaggatggg
gccctcaccctgctgcttgatgagttcgagaacatgtcggtgacccgctccaactccctg
cggagagacagcccgccgccgcccacccgggcccgccagcagaacgggatgcccgtggag
caggccaccacagccggagggggcccggagagagcgggccacggccgggtggctgggcgc
agcgaggggggtggcggcagtggcgacaggcggcgggcggggccggagaagaggcccaag
tcttccagggagggctcaggggcgccccaggagtcttcccgggacaaacgccccctctcc
gggcccgacgtcagcgccccccagcctgccggtctggccagtggggcgaaagtggcagct
ggccggccctttaacacgtacccgagggctgacacggaccacccatcccggggcacccag
ggggaccctcacaacctggcccccaatgggccctcagcggggagcctggctgtcccccag
tcctcttcccggcctcccgcccgagcccgcggcccccccagccctggggtgctgggcccc
cacgcctccgagccccagctggcccccgcggcccgcaccctcgcggcccctgccgccgcc
cccggcccccccggcccccgctcgcctcagcgggaaccccagcgagtatcccacgagcag
ttccgggctgccctgcagctggtggtggaccctggggaccctcgctcctacctggacaac
ttcatcaagatcggcgagggctccacgggcatcgtgtgcattgctaccgtgcgcagctcg
ggccggctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgcgagctgctc
ttcaatgaggtggtgatcatgcgggactaccagcacgagaacgtggtggagatgtacaac
agctacctggtgggcgacgagctctgggtggtgatggagttcctggagggaggcgccctc
accgacatcgtcacccacaccaggatgaacgaggagcagatcgccgccgtgtgcctggcc
gtgctgcaggccttgtctgtgctccacgcccagggcgtcatccaccgggacatcaagagc
gactccattctgctgacccacgacggccgggtgaagctgtcagacttcgggttctgtgcc
caggtgagcaaggaggtgccacggagaaagtcactggtcggcacgccctactggatggcc
ccggagctcatctcccgccttccctacgggccagaggtggacatctggtctctgggggtg
atggtgattgagatggtggacggggagcccccctacttcaacgagccacccctcaaagcc
atgaagatgattcgggacaacctgccgccccgactgaagaacctgcacaaggtgtcgcca
tctctgaagggcttcctggaccgcctgctggtgcgcgaccccgcgcagcgggccacggca
gccgagctgctgaagcacccgttcctggccaaagcgggcccgcccgccagcatcgtgcca
ctcatgcgccagaaccgcaccagatga

KEGG   Equus caballus (horse): 100071463
Entry
100071463         CDS       T01058                                 

Gene name
PAK6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04660  T cell receptor signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05170  Human immunodeficiency virus 1 infection
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100071463 (PAK6)
   04014 Ras signaling pathway
    100071463 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100071463 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100071463 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100071463 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    100071463 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100071463 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100071463 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100071463 (PAK6)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100071463 (PAK6)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100071463 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100071463
NCBI-ProteinID: XP_001501281
Ensembl: ENSECAG00000017471
UniProt: F6SBJ9
LinkDB
Position
1
AA seq 680 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSHIT
RVQLQPMKTVVRGSSVPSDGYISGLLSDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSEHTDPHGLYLSCNGGTPAGRRQTPWPEPQSPRVLPNGLATKAQSL
GPAEFQGATQRCLQLGACLQSSPPGTSPPTATGRRGAKAARHGSEEARPQSCLVGSAAGR
PGGEGSPSPKTQENSLKRRLFRSMFLSTPATAPLSSKPGPPLQSKPSSSFRPPQKGSPTS
LVAKAQSLPSDQPVGIFSPLTTSDTSSPQKSLRTAPATGPPPGRSSPAGSPRTRHAQIST
SNLYLPHDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIV
CLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHVNVVEMYKSYLVGEELWVLM
EFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRVK
LSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPY
FSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQT
GLPDCLVPLIQLYRKQTSAC
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcggccccacagaacttccagcac
cgcgttcacacctccttcgaccccaaggaaggcaagttcgtgggcctgcccccgcaatgg
cagaacattctggacacactgaggagaccgaagcccgtggtggacccttcccacatcacg
cgggtgcagctgcagcccatgaagacagtggtgcggggcagctctgtgccctcggacggc
tacatctccgggcttctcagcgatatccagaagttgtcggtcatcagctccaacaccctg
cgtggccgcagtcctaccagccggcggcgggcacaatccctggggctgctgggggatgag
cactgggccaccgacccggacatgtacctgcagagcccccagtctgagcacactgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccgcaggcagacgccgtgg
cccgagccgcagagcccacgggtcctgcccaatgggctggccaccaaggcacagtccctg
ggccccgccgagttccagggtgccacacagcgctgcctgcagcttggcgcctgtctgcag
agttccccgcctggcacctcaccccccacagccaccggtaggcgtggggccaaggctgcc
aggcatggctcggaggaggcccggccacagtcctgcctggtgggctccgctgcaggcagg
ccgggcggggagggcagccccagccctaagacccaggagaacagcctcaagcgcaggctg
ttccgaagcatgttcctgtccactcctgccacggcccctctgagcagcaagccaggccct
ccactgcaaagcaagcccagctcctctttccgaccgccacagaaaggctcccccacaagc
ctggtggctaaggcccagtccttgccttccgaccagcccgtggggatcttcagccctctg
accacctcagataccagcagcccccagaagtccctccgcacagccccagccactgggcca
cctccaggccggtcttccccagcgggctcaccccgcacccggcatgcccagatcagcacc
agcaacctgtacctgccccatgaccccacggtggccaagggtgccctggctggcgaggac
acaggtgttgtgacccacgagcagttcaaggctgcgctcaggatggtggtggaccagggc
gacccccggctgctgctggacagctacgtgaagattggcgagggctccacaggcatagtc
tgcctggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctcagg
aagcagcagcgcagggagctgctctttaatgaggtggtgatcatgcgggactaccagcac
gtcaacgtggtggagatgtacaagagctacctggtgggtgaggagctgtgggtgcttatg
gagttcctgcagggcggggccctcaccgacatcgtctcccaagtcaggctgaacgaggag
cagatcgccacagtgtgtgaggccgtgctgcaggccctggcttacctgcatgcccagggt
gtcatccaccgggacatcaagagtgactccatcctgctgaccctcgatggcagggtgaaa
ctctccgacttcggattttgtgctcagatcagcaaagatgtccctaagaggaagtccctg
gtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgcgaccgag
gtggatatctggtctctgggcatcatggtgattgagatggtggacggggagccaccgtac
ttcagcgactcaccagtgcaagccatgaagaggctccgggacagccctccacccaagctg
aaaaactctcacaaggtgtcccccgtgctgcgagacttcctggaacggatgctggtacgc
gacccccaggaaagggccaccgcccaggagctcctggaccaccccttcctgctgcagacg
gggctgcccgattgcctggtgcccctgatccagctctaccgcaagcagacctctgcctgc
tga

DBGET integrated database retrieval system