KEGG   Equus caballus (horse): 100051485
Entry
100051485         CDS       T01058                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04062  Chemokine signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04621  NOD-like receptor signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05142  Chagas disease
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100051485 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100051485 (PLCB4)
   04310 Wnt signaling pathway
    100051485 (PLCB4)
   04371 Apelin signaling pathway
    100051485 (PLCB4)
   04020 Calcium signaling pathway
    100051485 (PLCB4)
   04070 Phosphatidylinositol signaling system
    100051485 (PLCB4)
   04072 Phospholipase D signaling pathway
    100051485 (PLCB4)
   04071 Sphingolipid signaling pathway
    100051485 (PLCB4)
   04022 cGMP-PKG signaling pathway
    100051485 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100051485 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100051485 (PLCB4)
   04621 NOD-like receptor signaling pathway
    100051485 (PLCB4)
   04062 Chemokine signaling pathway
    100051485 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    100051485 (PLCB4)
   04922 Glucagon signaling pathway
    100051485 (PLCB4)
   04929 GnRH secretion
    100051485 (PLCB4)
   04912 GnRH signaling pathway
    100051485 (PLCB4)
   04915 Estrogen signaling pathway
    100051485 (PLCB4)
   04921 Oxytocin signaling pathway
    100051485 (PLCB4)
   04926 Relaxin signaling pathway
    100051485 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    100051485 (PLCB4)
   04918 Thyroid hormone synthesis
    100051485 (PLCB4)
   04919 Thyroid hormone signaling pathway
    100051485 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    100051485 (PLCB4)
   04916 Melanogenesis
    100051485 (PLCB4)
   04924 Renin secretion
    100051485 (PLCB4)
   04925 Aldosterone synthesis and secretion
    100051485 (PLCB4)
   04927 Cortisol synthesis and secretion
    100051485 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100051485 (PLCB4)
   04270 Vascular smooth muscle contraction
    100051485 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    100051485 (PLCB4)
   04971 Gastric acid secretion
    100051485 (PLCB4)
   04972 Pancreatic secretion
    100051485 (PLCB4)
   04973 Carbohydrate digestion and absorption
    100051485 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100051485 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100051485 (PLCB4)
   04725 Cholinergic synapse
    100051485 (PLCB4)
   04728 Dopaminergic synapse
    100051485 (PLCB4)
   04726 Serotonergic synapse
    100051485 (PLCB4)
   04720 Long-term potentiation
    100051485 (PLCB4)
   04730 Long-term depression
    100051485 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    100051485 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    100051485 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    100051485 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051485 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051485 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100051485 (PLCB4)
   05016 Huntington disease
    100051485 (PLCB4)
   05017 Spinocerebellar ataxia
    100051485 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    100051485 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051485 (PLCB4)
   04934 Cushing syndrome
    100051485 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100051485 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100051485 (PLCB4)
   05142 Chagas disease
    100051485 (PLCB4)
   05143 African trypanosomiasis
    100051485 (PLCB4)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100051485 (PLCB4)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100051485 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100051485 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 100051485
NCBI-ProteinID: XP_023481894
Ensembl: ENSECAG00000012335
VGNC: 21538
LinkDB
Position
22
AA seq 1206 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSVRLGASPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKTKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVSILEDDNEEEIESADQEEEAHPEYKFGNELSADDLGHKEAVANSVKKASD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNEKKGKANTAKANVTPQ
SSSELRPTTTAALGPGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSM
KLQNAN
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagtgccttcctttttgcaagaagga
gcagtttttgacagatatgaagaggaatcttttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacctggagaagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagtgttcggttgggagcctcaccaaaggatcccaaaatcctg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggtacagatctggtgaacatcagtttcacgtacatggtggctgaaaatccagaa
gtaacaaagcaatgggtcgaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacctttgcctcggggaaaacagaaaag
gtgatctttcaagcgctcaaggaattaggtcttcccagtggaaagaatgatgaaatcgag
cctgcggcatttacttatgaaaagttctatgaactgacgcaaaagatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgactgaatgagattttattt
ccattttatgatgctaaaagggcaatgcagatcattgagatgtatgagcccgatgaagat
ttgaagacaaaaggcctcatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aatgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacctatctcaccggccggcagtttggcgggaag
tcttcagtagaaatgtacagacaggtcctcctggctggttgcagatgtgttgaacttgac
tgttgggatggaaaaggtgaagaccaagaaccgataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgttattcaagccatcaaggaaactgcgtttgtcacatcc
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggacctcctgttgaaacaagcacttgaatcgcat
ccactcgaaccaggcaggcccttgccatcccccaatgacctcaaaagaaaaatactcatc
aaaaataaacggctgaaacctgaagttgaaaaaaaacagctcgaagctttgaaaagcatg
atggaagctggagaatctgctgccccagttagcatcttagaggatgataatgaagaggaa
atagaaagtgctgaccaagaggaggaagctcaccctgaatacaaatttggaaatgaactt
tctgctgatgacctgggtcacaaggaagctgttgcaaatagtgtcaagaaggcttcagat
gaccttgaacatgaaaacaacaaaaagggcctggttactgtagaagatgagcaggcgtgg
atggcgtcctataaatacgtgggtgctaccactaacatccatccctatctgtccacaatg
atcaactatgcacagcccgtgaaatttcaaggtttccatgtcgctgaagaacgcaatatt
cattataacatgtcttcttttaatgagtcagtcggtctaggctacctgaagacacatgcg
attgaatttgtgaattataacaaacgacaaatgagtcgtatttaccccaagggaggccga
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcctgcgggtaccttctcaaaccagatttcatgagacgacccgatcgaacatttgat
cccttctctgaaactcctgtcgatggggtcattgcagccacttgctcagtgcaggtcata
tcaggtcagttcttgtcagacaagaaaattggcacatatgtagaagttgacatgtatggg
ttgcccacggacactatacgtaaggagttccgaactcgcatggtgatgaacaatggactc
aatccagtttacaatgaagaatcatttgtatttcggaaggtaatcctccctgacctggca
gtcttgagaatagcagtgtatgatgacaacaacaggctgattggccagaggattcttcca
ctggatggcctccaagcaggttatcggcacatatcccttcgaaatgagggaaataaacca
ctatcactgccaacgattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtagatgctttatcagatccaaagaaatttctttccattacggaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgacatagctgatgtgcccagtgac
acttctaagaatgagaagaaaggaaaggccaacactgccaaagcaaatgtgaccccacag
agcagctccgagctcagaccaaccaccacagccgccctggggcctggcatggaagccaag
aaaggtattgaacttatccctcaagtaaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagctaaattctttaaagaagaaacatgcaaag
gaacacagtaccatgcaaaagctacactgcacgcaagttgacaaaatcgtggcacagtat
gacaaagagaagtcgactcatgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtcttgaaatgaaaaaagaaacagaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagattgtggcccagcacacaaaggagtggtcagaaatgatc
aacacccacagtgctgaggagcaagaaatccgggacctgcacctcagccagcagtgcgag
ctgctgagaaagctcctgatcagtgcccacgagcagcaaacccagcagctaaaactgtcc
catgacagggaaagcaaagaaatgagagcacaccaggctaagatttctatggaaaatagc
aaggccatcagccaagataaatctatcaagaataaagcagaacgggaaaggcgagtcagg
gagttaaacagcagcaatactaaaaagtttctggaagaaagaaagagacttgcaatgaaa
cagtccaaagaaatggatcagctgaaaaaagtccagcttgaacacctagaattcctagag
aaacagaatgagcagcttttgaaatcctgtcatgcagtgtcccaaacgcaaggcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatg
aaactccaaaacgcaaactga

KEGG   Equus caballus (horse): 100051558
Entry
100051558         CDS       T01058                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04062  Chemokine signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04621  NOD-like receptor signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05142  Chagas disease
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100051558 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100051558 (PLCB1)
   04310 Wnt signaling pathway
    100051558 (PLCB1)
   04371 Apelin signaling pathway
    100051558 (PLCB1)
   04020 Calcium signaling pathway
    100051558 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100051558 (PLCB1)
   04072 Phospholipase D signaling pathway
    100051558 (PLCB1)
   04071 Sphingolipid signaling pathway
    100051558 (PLCB1)
   04022 cGMP-PKG signaling pathway
    100051558 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100051558 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100051558 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100051558 (PLCB1)
   04062 Chemokine signaling pathway
    100051558 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    100051558 (PLCB1)
   04922 Glucagon signaling pathway
    100051558 (PLCB1)
   04929 GnRH secretion
    100051558 (PLCB1)
   04912 GnRH signaling pathway
    100051558 (PLCB1)
   04915 Estrogen signaling pathway
    100051558 (PLCB1)
   04921 Oxytocin signaling pathway
    100051558 (PLCB1)
   04926 Relaxin signaling pathway
    100051558 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    100051558 (PLCB1)
   04918 Thyroid hormone synthesis
    100051558 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100051558 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100051558 (PLCB1)
   04916 Melanogenesis
    100051558 (PLCB1)
   04924 Renin secretion
    100051558 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100051558 (PLCB1)
   04927 Cortisol synthesis and secretion
    100051558 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100051558 (PLCB1)
   04270 Vascular smooth muscle contraction
    100051558 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    100051558 (PLCB1)
   04971 Gastric acid secretion
    100051558 (PLCB1)
   04972 Pancreatic secretion
    100051558 (PLCB1)
   04973 Carbohydrate digestion and absorption
    100051558 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100051558 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100051558 (PLCB1)
   04725 Cholinergic synapse
    100051558 (PLCB1)
   04728 Dopaminergic synapse
    100051558 (PLCB1)
   04726 Serotonergic synapse
    100051558 (PLCB1)
   04720 Long-term potentiation
    100051558 (PLCB1)
   04730 Long-term depression
    100051558 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100051558 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    100051558 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    100051558 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051558 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051558 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100051558 (PLCB1)
   05016 Huntington disease
    100051558 (PLCB1)
   05017 Spinocerebellar ataxia
    100051558 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100051558 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051558 (PLCB1)
   04934 Cushing syndrome
    100051558 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100051558 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100051558 (PLCB1)
   05142 Chagas disease
    100051558 (PLCB1)
   05143 African trypanosomiasis
    100051558 (PLCB1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100051558 (PLCB1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100051558 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100051558 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 100051558
NCBI-ProteinID: XP_023481898
Ensembl: ENSECAG00000021224
VGNC: 21535
LinkDB
Position
22
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSAIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKCIGHRILPVQAIRPGYHYISLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPSLASDPGKLNHRPPSS
EELEGDNPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgctttgcaactcaagcctgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactctgctattgtcactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctgttagatctcagccttgtcaaggatgccagatgcgggaagcatgccaaagct
cccaaggaccccaagttgcgtgaacttttggatgtgggaaacatcgggcgcctggaacat
cgcatgataacggtggtatatgggcctgacttagttaacatctcccatttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggtttttagtttggcaacaaac
ctgctggcccaaaacatgtccagggacgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcgaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttccgaatttggtgccaaaagcaaaccatacctt
actgttgatcagatgatggattttatcaatcttaaacagcgagatcctcggctaaatgaa
atactttacccacctttaaagcaagaacaagtccaagtattgattgagaagtatgaaccc
aacaatagtctcgccaaaaaaggacagatatcagtggacggattcatgcgctatctgagt
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagatatgtctcag
cctctttctcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcctccgtcgagatgtaccgccaagtgcttctgtctggttgtcgctgcgta
gagttggactgctggaagggacggaccgcagaagaggaaccagtcatcacccatgggttc
accatgacaactgaaatatccttcaaggaagtgatagaagcaattgctgagtgtgcattt
aagacttcaccttttccaattctgctttcatttgagaaccacgtggactccccaaagcag
caagccaagatggcggagtattgccggctcatctttggggacgcccttctcatggaacca
ctggaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataaaaagaagtcacacaagtcatcagaaggaagtggcaaaaag
aagctctcggaacaagcctccaacacgtacagcgactcctccagtgtgttcgagccctcg
tctccgggagccggggaagctgacacagagagcgacgatgatgacgatgacgatgactgt
aaaaaatcttcaatggatgagggcactgctgggagcgaggccatggccacagaagagatg
tctaacctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaatagaagttttgaaatgtcttccttcgtggaaaccaaaggacttgagcaacttacg
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
gggacacgcgtggattcatccaactacatgcctcagctcttctggaacgcaggttgccaa
atggttgcccttaatttccaaacagtggacctggctatgcaaataaatatggggatgtat
gaatataacgggaagagtggctacagattaaagccagagttcatgaggagacctgataag
cattttgatccattcactgaaggcatcgttgatgggatagtggccaacactttatctgtt
aagattatttccggtcagtttctttctgataagaaagttgggacttacgtagaagtggac
atgttcggtttgccggtggacacaaggaggaaggcattcaagaccaagacatcacaagga
aacgctgtcaatcccgtctgggaagaagaacccattgtcttcaaaaaggtggtccttcct
tctctggcctgtttgaggatagcagtttatgaagaaggaggcaaatgtatcggtcaccgg
atcttgccagtgcaagcaattcgaccaggctatcactacatctctctgaggaatgagagg
aaccagcctctgatgctaccagctgtctttgtctacatagaggtgaaagactatgtccca
gatacatatgcagatgtgattgaagctttgtcaaatccaatccgctatgtgaatctgatg
gagcagagagctaagcaactggctgctttgacactggaagatgaagaagaagtgaagaaa
gaggctgatcctggggaaacaccatcggaggctccgagtgaagccaggacaactccagca
gaaaacggagtgaatcacactacatccctgacacctaaacctccctcccaggctctccac
agccagccagctccaggttctgtaaaggcaccggccaaaacagaagatctcattcagagt
gttttaacagaagtggaagcgcagactattgaagagctaaagcaacagaaatcgttcgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagagcacactacaaaatataatgaaattcagaatgactacttg
agaaggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcggaaccc
agcagtcctgaccatggttcatcgacaattgagcaagaccttgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacagcagcagcagctgcttaatcttcga
caagaacagtattatagtgaaaaataccagaagcgagaacatattaagttgcttattcaa
aaattgacggatgttgctgaagaatgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagagaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaagaggaaaagacagagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcgcaaagtaaacga
caagaaaaactggtagagaaacacaaggagatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagagtaccaagacaagttcaaaagactacccctggag
attttggagttcgtgcaggaagccatgaaagggaaaatcagtgaagacagcaatcacagt
tctgcccctccctctctggcctcagaccctggcaaactgaaccacagacctccctccagt
gaggagctggaaggagacaacccaggaaaagagtttgataccccgctgtga

KEGG   Equus caballus (horse): 100055407
Entry
100055407         CDS       T01058                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04062  Chemokine signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04621  NOD-like receptor signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05142  Chagas disease
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100055407 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100055407 (PLCB3)
   04310 Wnt signaling pathway
    100055407 (PLCB3)
   04371 Apelin signaling pathway
    100055407 (PLCB3)
   04020 Calcium signaling pathway
    100055407 (PLCB3)
   04070 Phosphatidylinositol signaling system
    100055407 (PLCB3)
   04072 Phospholipase D signaling pathway
    100055407 (PLCB3)
   04071 Sphingolipid signaling pathway
    100055407 (PLCB3)
   04022 cGMP-PKG signaling pathway
    100055407 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100055407 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100055407 (PLCB3)
   04621 NOD-like receptor signaling pathway
    100055407 (PLCB3)
   04062 Chemokine signaling pathway
    100055407 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    100055407 (PLCB3)
   04922 Glucagon signaling pathway
    100055407 (PLCB3)
   04929 GnRH secretion
    100055407 (PLCB3)
   04912 GnRH signaling pathway
    100055407 (PLCB3)
   04915 Estrogen signaling pathway
    100055407 (PLCB3)
   04921 Oxytocin signaling pathway
    100055407 (PLCB3)
   04926 Relaxin signaling pathway
    100055407 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    100055407 (PLCB3)
   04918 Thyroid hormone synthesis
    100055407 (PLCB3)
   04919 Thyroid hormone signaling pathway
    100055407 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100055407 (PLCB3)
   04916 Melanogenesis
    100055407 (PLCB3)
   04924 Renin secretion
    100055407 (PLCB3)
   04925 Aldosterone synthesis and secretion
    100055407 (PLCB3)
   04927 Cortisol synthesis and secretion
    100055407 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100055407 (PLCB3)
   04270 Vascular smooth muscle contraction
    100055407 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    100055407 (PLCB3)
   04971 Gastric acid secretion
    100055407 (PLCB3)
   04972 Pancreatic secretion
    100055407 (PLCB3)
   04973 Carbohydrate digestion and absorption
    100055407 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100055407 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100055407 (PLCB3)
   04725 Cholinergic synapse
    100055407 (PLCB3)
   04728 Dopaminergic synapse
    100055407 (PLCB3)
   04726 Serotonergic synapse
    100055407 (PLCB3)
   04720 Long-term potentiation
    100055407 (PLCB3)
   04730 Long-term depression
    100055407 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    100055407 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    100055407 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    100055407 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100055407 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055407 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100055407 (PLCB3)
   05016 Huntington disease
    100055407 (PLCB3)
   05017 Spinocerebellar ataxia
    100055407 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    100055407 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100055407 (PLCB3)
   04934 Cushing syndrome
    100055407 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100055407 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100055407 (PLCB3)
   05142 Chagas disease
    100055407 (PLCB3)
   05143 African trypanosomiasis
    100055407 (PLCB3)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100055407 (PLCB3)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100055407 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100055407 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 100055407
NCBI-ProteinID: XP_023510066
Ensembl: ENSECAG00000011700
VGNC: 21537
LinkDB
Position
12
AA seq 1230 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDANGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRHSQARQLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPGS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVALEKPSLEPQKSLGE
EGPQRGPDALGPVDREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQAGPETCQETQSQQL
GSQLTPNPTPSTLDTSPRRPPGTVTSPTSPSLSSPGQRDDLVASILAEVAPAPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVALTRRLLDGLAQARAEGRCRPRPGGLGGEDEKEE
EKEVKHYQEFQKRQVQSLLELREAQADTESKWRLEHLRQAQQRLREVVLDAHTTQLKRLK
ETNDREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQK
QRQERLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEVRRSLLGETPEGLGDGHL
VACASNGHAPGSSGHLSGADSESQEENTKL
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcaggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgcgtggacgccaatggcttctttttgtactggacaggacccaacatggaa
gtggacacactggacatcagttccatcagggacacgcggacaggccgttacgcccgcctg
cccaaggaccccaagatccgggaggtgctgggctttgggggccccgatgcccggctggag
gagaagctgatgacggtggtggccgggccagacccggtgaacacgacattcttgaacttc
atggccgtgcaggacgacacagccaaggtctggtccgaggagctgttcaagctggctatg
aacatcctggctcagaatgcctcccggaacaccttcttgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatgggaggatcccggtgaagaacatcctgaagatgttctca
gcagacaagaagcgggtggaaactgcgctggaatcctgtggcctcaatttcaatcggagc
gagtccatccggcccgacgagttttccttggaaatcttcgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctagagcagctcatggacttcatcaaccagaagcagcgggacccgaggctcaac
gaggtgctgtacccgcccctgcggcactcccaggcgaggcagctcatcgagaagtacgaa
cccaaccagcagttcctggagcgagaccagatgtccatggaaggtttcagccgctacctg
ggaggtgaggagaacggcatcctgcccctggaggccctggacctgagcgccgacatgacg
cagccgctcagtgcttacttcatcaactcttcccataacacctacctcacggcggggcag
ctggccgggacctcgtcggtggagatgtaccggcaggcgctgctgtggggctgccgctgc
gtggagctggacgtgtggaaggggcggccgcccgaggaggagccattcatcacgcacggc
ttcaccatgaccaccgaggtgccgctgcgggacgtgctcgaggccatcgcggagaccgcc
ttcaagacctcgccctaccccgtcatcctctccttcgagaaccacgtggactcggcaaag
cagcaggccaagatggccgagtactgccgctccatctttggggacgcgctgctcatcgac
ccactggacaagtacccgctggccccaggcgtccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaataagaagcggcaccagcccagcacgggcgtccccggcagc
tccgtgcgcaagaggccgctggagcagagcaactcggccctgagcgagagctctgccgcc
accgagccttcctcgccccagctcgggtcccccagctccgacagctgccccggcctgagc
aacggggaggaggtggccctcgagaagcccagcctggagcctcagaagtctctgggggag
gaggggccgcagcggggccccgatgctcttggacctgttgaccgcgaggatgaggaggaa
gacgaggaagaggaggaacagacggaccccaaaaagcccaccacggatgagggcaccgcc
agcagcgaggtcaatgccacagaggaaatgtcgaccctcgtcaactacatcgagcccgtc
aagttcaagtccttcgaggctgcccgaaagaggaacaagtgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcagctgaccaagagccccatggagttcgtggaatacaac
aagcagcagctgagccgtatctaccccaagggcacccgcgtggactcgtctaactacatg
ccccagctcttctggaatgtgggctgccagcttgtcgcgctcaacttccagaccctggat
gtggcgatgcagctcaacgcgggcgtgttcgagtacaacgggcgcagcggctacctgctt
aaacccgagttcatgcggcggccggacaagtcctttgaccccttcaccgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggatatgttcggcctccctgtggacacgcggcgc
aagtaccgcacgcggacctctcaggggaactcgttcaaccccgtgtgggatgaggagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcactgcgcatcgcggcttttgag
gagggcggcaagttcgtggggcaccggatcctgcccgtctctgccatccgctcagggtac
cactacatctgcctgcggaacgaggccaaccagccgctgtgcctgccggccctgctcatc
tacaccgaggcctccgactacatccctgacgaccaccaggactacgcagaggccctgatc
aaccccatcaagcatgtcagcctgatggaccagagggccaagcagctggctgccctcatt
ggggagagcgaggctcaggctggcccggagacatgccaggagacccagtctcagcagctg
gggtcccagctgaccccaaaccccacacccagcacactggacacctccccccgccggccc
ccaggcactgtcacctcccccaccagtccgtccctcagcagcccaggccaacgggatgat
ctcgtcgccagcatcctcgcagaggtggccccagccccactggacgagctccgaggccac
aaggctctggtgaagctccggagccggcaggagcgagacctgcgggagctgcgcaagaag
catcagcggaaggccgtagccctcactcgccgcctgctcgacggcctggcccaggctcgg
gccgagggcaggtgccggccccggccaggtggcctaggcggggaggacgagaaggaggag
gagaaagaggtgaagcactatcaggagttccagaaaagacaggtgcagagtctgctggag
ctgagggaggcccaggccgacacagagagcaagtggaggctggagcacctgcgacaggct
cagcagcggctcagggaggttgtcctggatgcacacacaacccagttaaagaggctgaag
gagacgaacgacagggagaagaaggaactgcagaagatcctggacaggaagcgccacaac
agtatctcggaggccaagacaagggagaaacataagaaggaggcggaactgaccgagatc
aaccgtcggcacatcactgagtcggtcaactccatccgtcggctggaggaggcccagaag
cagcggcaggagcgccttgtggccgggcagcagcaggtcctgcagcagctggcagaagag
gagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgggcaaggctgccc
caggaggtccgccggagcctgctgggcgagacgccggaggggctgggggacgggcatctg
gtggcctgtgccagcaacggtcacgcgcccgggagcagcgggcacctgtctggtgctgac
tcggagagccaagaggagaatacgaagctctga

KEGG   Equus caballus (horse): 100057315
Entry
100057315         CDS       T01058                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04062  Chemokine signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04621  NOD-like receptor signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04742  Taste transduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05142  Chagas disease
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100057315 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100057315 (PLCB2)
   04310 Wnt signaling pathway
    100057315 (PLCB2)
   04371 Apelin signaling pathway
    100057315 (PLCB2)
   04020 Calcium signaling pathway
    100057315 (PLCB2)
   04070 Phosphatidylinositol signaling system
    100057315 (PLCB2)
   04072 Phospholipase D signaling pathway
    100057315 (PLCB2)
   04071 Sphingolipid signaling pathway
    100057315 (PLCB2)
   04022 cGMP-PKG signaling pathway
    100057315 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100057315 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100057315 (PLCB2)
   04621 NOD-like receptor signaling pathway
    100057315 (PLCB2)
   04062 Chemokine signaling pathway
    100057315 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    100057315 (PLCB2)
   04922 Glucagon signaling pathway
    100057315 (PLCB2)
   04929 GnRH secretion
    100057315 (PLCB2)
   04912 GnRH signaling pathway
    100057315 (PLCB2)
   04915 Estrogen signaling pathway
    100057315 (PLCB2)
   04921 Oxytocin signaling pathway
    100057315 (PLCB2)
   04926 Relaxin signaling pathway
    100057315 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    100057315 (PLCB2)
   04918 Thyroid hormone synthesis
    100057315 (PLCB2)
   04919 Thyroid hormone signaling pathway
    100057315 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100057315 (PLCB2)
   04916 Melanogenesis
    100057315 (PLCB2)
   04924 Renin secretion
    100057315 (PLCB2)
   04925 Aldosterone synthesis and secretion
    100057315 (PLCB2)
   04927 Cortisol synthesis and secretion
    100057315 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100057315 (PLCB2)
   04270 Vascular smooth muscle contraction
    100057315 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    100057315 (PLCB2)
   04971 Gastric acid secretion
    100057315 (PLCB2)
   04972 Pancreatic secretion
    100057315 (PLCB2)
   04973 Carbohydrate digestion and absorption
    100057315 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100057315 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100057315 (PLCB2)
   04725 Cholinergic synapse
    100057315 (PLCB2)
   04728 Dopaminergic synapse
    100057315 (PLCB2)
   04726 Serotonergic synapse
    100057315 (PLCB2)
   04720 Long-term potentiation
    100057315 (PLCB2)
   04730 Long-term depression
    100057315 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    100057315 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    100057315 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    100057315 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100057315 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057315 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100057315 (PLCB2)
   05016 Huntington disease
    100057315 (PLCB2)
   05017 Spinocerebellar ataxia
    100057315 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    100057315 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100057315 (PLCB2)
   04934 Cushing syndrome
    100057315 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100057315 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100057315 (PLCB2)
   05142 Chagas disease
    100057315 (PLCB2)
   05143 African trypanosomiasis
    100057315 (PLCB2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100057315 (PLCB2)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100057315 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100057315 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 Gp58 Exonuc_VII_L
Other DBs
NCBI-GeneID: 100057315
NCBI-ProteinID: XP_001918335
Ensembl: ENSECAG00000020647
VGNC: 21536
LinkDB
Position
1
AA seq 1184 aa
MSLLNSVLLPRKVKSYLSQGERFIKWDDETTTASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALVKHPLTANAPRSTFLDKILVKLQMQLNLEGKIPVKNLFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LAKFINQKQRDPRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SLLVQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKTPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSAYPVILSFENHVDSPRQQAKM
AEYCRTMFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNLFSGPADPSKELDGE
AEGSPPPSDPVGGDTVWAGEEGTELEEEVEEEEESGSLDEEEMKKMQSDEGTAGLEVTAY
EEMSSLVNYIQPTKFISFEFSAQKNQSYVISSFTELKAYDLLSKAPVQFVDYNKRQMSRI
YPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMRR
QDKQFNPFSVDGIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKLS
PSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCLH
SESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFNAQDKKSVKLKEAMGGLPEK
PFLPANPVPSQVNGALALTSNGSAGAGARAREEVTKEAAEPRTVSLDELRELKGFAKLQR
RHEKELRELERRGVRRWEELLQRGAVQRAGLGSPGAGGGCTGRRLGPGKGSRKKRSLPGG
EEPTGAAPGEGPEGEDAHVQELRDRLELELLQLGEEHYDCILKRKEQHVAEQIAKMMELA
REKHAAELKTLKETSEIDIKEMKKKLEARRLERIQAMIKITTDKMAQERLKREVNNSHIQ
EVVQVIKQMSENLERDQEKLEEKQAACLEQIREMEKKFQQEALAEYETRMKGLEAKMKES
VRGCLRACFPSEAEGKPERPCGASGELCEQDPLTAEADTEESRL
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgtctctgctcaactctgtcctgctgccccgcaaggtgaaaagttatctaagccaaggg
gagcgcttcatcaaatgggacgatgaaaccacaacagcctccccggttatcctccgcgtg
gatcccaagggctattacttatactggacgtatcagagtaaggagatggagtttctggat
atcaccagcatccgggacacccgctttgggaagtttgccaagatacccaagagccagaag
ctccgggatgtcttcaacatggactttcctgacaataacttcctgctgaagacactcact
gtggtgtccggacccgacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggactgggctgaagatgtactggctctggtcaagcacccgctgacggcc
aatgccccccgcagcaccttcctggacaagatcctggtcaagctccagatgcagctcaac
ttggaagggaagattcctgtgaagaatcttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgccctcagtgcctgccacctcccaaaaggcaagaatgacgccatcaatcct
gaggacttcccggaatccgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcctaccatgccaaggccaaaccctacatgaccaaggagcac
ctggccaaattcatcaaccagaaacagcgggatccccgcctcaactccttgctgttcccg
ccagctcggcctgaccaggtgcaaggcctcatcgacaagtatgagcccagtggcatcaac
gtgcagaggggccagttgtcacctgaaggcatggtgtggtttctctgtgggccggagaac
agtttgctggtccaggacaagctgctgctccaccatgacatgacacagccactcaatcat
tacttcatcaattcctcacacaacacctacctgacagccggtcagttctcaggcctttcc
tcggctgagatgtaccgccaggtgctgctggctggctgccgctgtgtggagctggactgc
tggaaggggaagacccccgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatctatttcaaggaggcaattgaagctattgcagaaagtgcctttaagacctccgcc
taccctgtcatcctgtcatttgaaaaccacgtggactcacctcgccaacaggccaagatg
gctgagtactgccggacgatgtttggggacatgctgctcacagagcccctggaaaagttc
ccattaaaaccaggcatccccctgcccagccctgaggatctccgtggcaagatcctcatc
aagaacaagaaaaacctgttttccggcccagcagaccccagcaaggagctggatggggag
gctgagggcagccccccacccagtgatcctgtgggtggggacacagtgtgggctggtgag
gaagggactgagctggaggaggaggtggaagaggaggaagagtcaggaagcctggacgaa
gaagagatgaagaagatgcagtcagatgagggtacagcgggcctagaggtgacagcttac
gaggagatgtccagccttgtcaattatatccagcctaccaagttcatttcctttgagttt
tctgcccagaagaaccaaagttatgtcatctcctccttcacagagctcaaggcttatgac
ctgctctccaaggcccccgtacagtttgtggactacaacaagcgccagatgagccgcatt
taccccaagggcacccgcatggactcctccaactacatgccccagatgttctggaatgct
ggttgccagatggtcgccctcaacttccagacgatggacctgcccatgcagcagaacatg
gcgctgtttgagttcaatggccagagtggctacctcctcaagcatgagttcatgcgccgg
caggacaagcagttcaaccctttctctgtggatggcatcgacgtggtggtggccaccact
ctttccattacggtgatctctgggcagttcctgtcagaacgcagtgtgcgcacctatgtg
gaagtggagctgtttggccttcctggggaccccaagaggcgctatcgcaccaagctgtca
cccagtaccaactccatcaatcctgtctggaaggaggagccctttgtctttgagaagatc
ttgatgccagagctggcctccctcagggtggctgtgatggaggaaggcaacaagtttctt
ggacaccgcatcatccccatcaatgctctgaattctggataccaccatctatgcctgcac
agcgagagcaacatgcccctcaccatgcctgcactctttgtcttcctggagatgaaggac
tatgtacctgacacctgggcagatctcaccgtggccctcgccaatcccatcaagttcttt
aatgcccaagataagaagtctgtgaagctcaaggaagccatgggaggtctgcctgagaag
cccttcctgcctgcgaatccagttcccagccaggtcaacggggcactggccctaacgagc
aatgggtcagcaggagctggggccagggccagggaggaggtcacgaaagaagctgcagag
ccacggaccgtcagcctggatgagctgcgggagctgaagggcttcgcgaagctgcagcgg
cggcacgagaaggagcttcgggagctggagcggcgcggcgtgcggcgctgggaggagctg
ttgcagaggggtgcggtgcagcgggccgggctcgggtcgccgggcgcggggggcggctgc
acgggccgcaggctcggcccgggcaagggctcccgcaagaagaggagcctgccaggtgga
gaggagcccaccggggccgccccgggcgagggccccgaaggtgaggacgcgcacgtgcaa
gagctgcgggacaggctggagttggagctgctgcagctgggcgaggagcactacgattgc
atcctgaagcgcaaagagcagcacgtggctgagcaaatcgccaagatgatggagctggcc
agagagaaacatgcggcagagctgaagaccctcaaggagacctcagagattgacatcaaa
gagatgaagaaaaagctggaggccaggaggctggaacggatccaggccatgatcaagatc
accacggacaagatggcccaggagaggttgaagagagaggttaacaactcccacatccag
gaggtggtgcaggtcatcaagcagatgtcagagaacctggagagggaccaggagaagctg
gaggagaagcaggcagcctgcctggaacagatccgggagatggaaaagaagtttcagcaa
gaggcgctggcagagtacgagaccaggatgaagggcctggaggccaagatgaaggagtcg
gtgagaggctgcctcagggcctgtttcccctcagaggcagagggcaagcctgagaggccc
tgtggggcctccggggagctgtgtgagcaggacccacttacagcagaggcagataccgag
gagagccgcctctga

DBGET integrated database retrieval system