KEGG   Equus caballus (horse): 100051632
Entry
100051632         CDS       T01058                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04024  cAMP signaling pathway
ecb04210  Apoptosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04713  Circadian entrainment
ecb04725  Cholinergic synapse
ecb04728  Dopaminergic synapse
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04932  Non-alcoholic fatty liver disease
ecb04935  Growth hormone synthesis, secretion and action
ecb05031  Amphetamine addiction
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05161  Hepatitis B
ecb05162  Measles
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05224  Breast cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05323  Rheumatoid arthritis
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100051632 (FOS)
   04668 TNF signaling pathway
    100051632 (FOS)
   04024 cAMP signaling pathway
    100051632 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100051632 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100051632 (FOS)
   04660 T cell receptor signaling pathway
    100051632 (FOS)
   04658 Th1 and Th2 cell differentiation
    100051632 (FOS)
   04659 Th17 cell differentiation
    100051632 (FOS)
   04657 IL-17 signaling pathway
    100051632 (FOS)
   04662 B cell receptor signaling pathway
    100051632 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100051632 (FOS)
   04917 Prolactin signaling pathway
    100051632 (FOS)
   04921 Oxytocin signaling pathway
    100051632 (FOS)
   04926 Relaxin signaling pathway
    100051632 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100051632 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100051632 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100051632 (FOS)
   04728 Dopaminergic synapse
    100051632 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100051632 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100051632 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051632 (FOS)
   05231 Choline metabolism in cancer
    100051632 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100051632 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051632 (FOS)
   05224 Breast cancer
    100051632 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100051632 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100051632 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100051632 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100051632 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100051632 (FOS)
   05135 Yersinia infection
    100051632 (FOS)
   05133 Pertussis
    100051632 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051632 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100051632 (FOS)
   05161 Hepatitis B
    100051632 (FOS)
   05171 Coronavirus disease - COVID-19
    100051632 (FOS)
   05162 Measles
    100051632 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100051632 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100051632 (FOS)
   05142 Chagas disease
    100051632 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100051632 (FOS)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100051632 (FOS)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100051632 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 100051632
NCBI-ProteinID: XP_001492022
Ensembl: ENSECAG00000014260
VGNC: 18095
LinkDB
Position
24
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRTGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFMFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPLASELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc
tccccggccggggacagtctctcctactaccactcgccggccgactccttctccagtatg
ggctctccggtcaatgcgcaggactactgcacggatttggccgtctccagtgccaacttc
atcccaacggtaactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctcggtagccccatcccagaccagagctcctcacccctatggagtccccacc
ccctcggctggggcttactccaggacgggagtcgtgaagaccatgacaggaggcagagct
cagagcattggcagaaggggcaaggtggaacagttgtctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag
ctgactgacacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaaccttctgaaggagaaggaaaaactagagttcatcctggcagctcac
cggcctgcctgcaagatccccgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc
ctgcccctccttaacgatcctgagcccaagccctcagtggagcctgtcaagagcatcagc
agcatggagctgaaggctgagccctttgatgacttcatgttcccagcatcgtcccggccc
agtggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcacggtggctccctggggatggggcccctggcctcagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcaccacttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system