KEGG   Equus caballus (horse): 100051790
Entry
100051790         CDS       T01058                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04914  Progesterone-mediated oocyte maturation
ecb04934  Cushing syndrome
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05215  Prostate cancer
ecb05222  Small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100051790 (CDK2)
   04151 PI3K-Akt signaling pathway
    100051790 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100051790 (CDK2)
   04114 Oocyte meiosis
    100051790 (CDK2)
   04115 p53 signaling pathway
    100051790 (CDK2)
   04218 Cellular senescence
    100051790 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100051790 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051790 (CDK2)
   05203 Viral carcinogenesis
    100051790 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100051790 (CDK2)
   05215 Prostate cancer
    100051790 (CDK2)
   05222 Small cell lung cancer
    100051790 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100051790 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100051790 (CDK2)
   05161 Hepatitis B
    100051790 (CDK2)
   05160 Hepatitis C
    100051790 (CDK2)
   05162 Measles
    100051790 (CDK2)
   05169 Epstein-Barr virus infection
    100051790 (CDK2)
   05165 Human papillomavirus infection
    100051790 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100051790 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecb03032]
    100051790 (CDK2)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100051790 (CDK2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100051790 (CDK2)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100051790 (CDK2)
DNA replication proteins [BR:ecb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100051790 (CDK2)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100051790 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100051790
NCBI-ProteinID: XP_001504840
Ensembl: ENSECAG00000021177
VGNC: 16345
LinkDB
Position
6
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDDSVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALTHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaagttgacgggagaagtggtcgcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgccatccgggagatctctctgcttaaggagcttaaccac
cctaatattgtcaagctgctggatgtcatccacacagaaaacaaactctacctggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagctttctgccattct
catcgggtcctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttatact
catgaggtggtgaccctgtggtaccgagcacctgaaatccttttgggttgcaaatactac
tccacagctgtggacatctggagcctgggctgcatctttgctgagatggtgacccggcgg
gccctattccctggagattctgagattgaccaactcttccggatctttcgaactctgggg
accccagatgactcggtttggccaggagttacttccatgcctgattataagccaagtttc
cccaagtgggcccggcaagattttagcaaagttgtgcctcccctggatgaagatggacgg
agcttgttatcgcaaatgctgcactacgaccccaacaagcggatttcggcaaaggcagct
ctgactcaccctttcttccaggatgtgaccaagccagtaccccaccttcgactctga

DBGET integrated database retrieval system