KEGG   Equus caballus (horse): 100051983
Entry
100051983         CDS       T01058                                 

Gene name
TFE3
Definition
(RefSeq) transcription factor E3 isoform X1
  KO
K09105  transcription factor E3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04137  Mitophagy - animal
ecb05202  Transcriptional misregulation in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100051983 (TFE3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100051983 (TFE3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100051983 (TFE3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100051983 (TFE3)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    100051983 (TFE3)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 100051983
NCBI-ProteinID: XP_001494946
Ensembl: ENSECAG00000020642
VGNC: 24038
UniProt: F6T5E1
LinkDB
Position
X
AA seq 575 aa
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENILD
PDSFYELKSQPLSLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQL
MRAQAQEQERRERREQAAASSFPSPAPASPAISVVGVSAGGHALGRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGAASAQPLPAPEAAHTAGPT
GSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVSG
NLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRF
NINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDVEEEGRPGTATFHAG
GGPAQGAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
LSPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtctcatgcggccgagccagctcgggacggcgtagaggccagcgcagagggccctcga
gccgtgttcgtgctgttggaggagcgcaggccggccgactcggcccagctgctcagcctg
aactctttgcttccggagtccgggattgttgctgacattgaattagaaaacatccttgat
cctgacagcttctacgagctcaaaagccaacccctatcacttcgctcaagcctcccaata
tcactgcaggccacaccagccaccccagctacactctctgcatcatcttctgcagggggc
tccaggacccctgccatgtcgtcctcttcctcctcgcgggtcttgctgcggcagcagcta
atgcgggcccaggcccaggagcaggagaggcgtgagcgccgggaacaggctgcagcctct
tccttccccagtcctgcacctgcctctcctgccatctctgtggtcggcgtctctgctggg
ggccacgcattgggccgccctccccctgctcaggtgcccagggaggtgctcaaggtgcaa
acccatctggagaacccaacgcgctaccacctgcagcaggcgcgccggcagcaagtgaag
cagtacctgtccaccacccttgggcccaagctggcttcccaggccctcaccccaccgccg
ggggctgccagtgcccagccgctccctgcccccgaggctgcccacactgctggccccaca
ggcagtgctcccaacagccccatggcactgctcaccatcgggtccagctcagaaaaggag
attgatgatgtcattgatgagatcatcagcctggagtccagttacaacgatgagatgctc
agctatctgcccggaggcaccgctgggctgcagctccccagcacgctgcctgtgtcaggg
aatctgcttgatgtgtacagtagtcagggtgtggccacgccagccatcaccgtcagcaac
tcctgcccagctgagctgcccaacatcaaacgggagatctctgagacagaggccaaggcc
cttttgaaggagcgacagaagaaagacaatcacaacctcattgagcgtcgcaggcgattc
aacattaacgacaggatcaaggagctgggcaccctcatccccaagtccagtgacccggag
atgcgctggaacaagggcaccatcctcaaagcctctgtggattacatccgcaagttgcag
aaggagcaacagcgctccaaagacctggagagccggcagcgatccctggagcaagccaac
cgcagcctgcagctccgaattcaggagctagaactgcaggctcagatccatggtctgccg
gtacctcccaccccagggctgctctccctggccacaacttcagcctctgacagcctcaag
ccagagcagctggacgttgaggaggagggcaggccaggcacagcaacgtttcatgcaggg
gggggacctgcccagggtgctccccatcagcagcccccagcgcccccctcggatgccctt
ctggacctgcactttcccagcgaccacctgggggatctgggggaccccttccacctgggg
ctggaggacattctgatggaggaggaggaaggggtggtgggaggactgtcggggggtgcc
ctgtccccactgcgggctgcctctgatcccctgctctcttcggtatcccccgctgtctcc
aaggccagcagtcgccgcagtagcttcagcatggaggaggagtcctga

DBGET integrated database retrieval system