KEGG   Equus caballus (horse): 100052084
Entry
100052084         CDS       T01058                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb04144  Endocytosis
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04625  C-type lectin receptor signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100052084 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100052084 (MDM2)
   04151 PI3K-Akt signaling pathway
    100052084 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100052084 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100052084 (MDM2)
   04115 p53 signaling pathway
    100052084 (MDM2)
   04218 Cellular senescence
    100052084 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100052084 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100052084 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100052084 (MDM2)
   05202 Transcriptional misregulation in cancer
    100052084 (MDM2)
   05206 MicroRNAs in cancer
    100052084 (MDM2)
   05205 Proteoglycans in cancer
    100052084 (MDM2)
   05203 Viral carcinogenesis
    100052084 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100052084 (MDM2)
   05220 Chronic myeloid leukemia
    100052084 (MDM2)
   05218 Melanoma
    100052084 (MDM2)
   05219 Bladder cancer
    100052084 (MDM2)
   05215 Prostate cancer
    100052084 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100052084 (MDM2)
   05169 Epstein-Barr virus infection
    100052084 (MDM2)
   05165 Human papillomavirus infection
    100052084 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100052084 (MDM2)
   01522 Endocrine resistance
    100052084 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100052084 (MDM2)
   04121 Ubiquitin system [BR:ecb04121]
    100052084 (MDM2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100052084 (MDM2)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100052084 (MDM2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100052084 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100052084
NCBI-ProteinID: XP_005611430
Ensembl: ENSECAG00000013604
VGNC: 20059
UniProt: A0A3Q2H2X5
LinkDB
Position
6
AA seq 491 aa
MCNTNMSVSTDGAVSTAQIPAAEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDERQQHMVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQPEPSDSGT
SVSENSCPLEGGSDQKAAVQELQEEKPSSSALVSRPPTSSRRRAISETEENSDELPGERQ
RKRHKSDSVSLSFDEGLALCVIREICCDGGSSSESAGTPSDPDLDAGVSERSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQEPSDDDDEVYRVTVYQAEESDTDSFEEDPEISLA
DYWKCTSCGETNPPLPSHCSRCWALRESWLPEGKAKAPGSGSGIVAPEGSGPGEEGVDVP
DCRKTEGGHPREACTEDDDAAAAQASQSQESEGCSQPPASTSGAHSSQEGPGELEREDAP
DKEESVEASLPLNATEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKRRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtccactgatggtgcagtaagcaccgcgcagatccca
gctgcggagcaggagaccctggttagaccaaagccattgcttctgaagttgttgaagtct
gtcggtgcacaaaaggacacttatactatgaaagaggtgatcttctaccttggccagtat
atcatgactaagcggctgtacgacgagaggcagcagcacatggtgtactgctccaacgat
ctgctgggggacctgttcggcgtgcccagcttctctgtgaaagaacacaggaaaatatat
acgatgatctacagaaacttggtggtcgtcaatcagccggaaccatcagattcaggcaca
tctgtgagtgaaaacagttgtccccttgaaggtgggagtgatcaaaaggccgctgtgcag
gagctgcaggaagagaagccgtcgtcttcggctttggtgtctaggccgcccacgtcatct
aggaggagagccatcagtgagacggaagaaaactccgacgagttgcctggtgagcggcag
aggaagcgccacaagtccgacagcgtctcgctgtccttcgacgagggcctcgcgctgtgt
gtcatccgggagatctgctgcgacggcggcagcagcagcgagtcagccgggacgccgtcc
gatccggatctggatgctggcgtcagtgaacgctcaggtgactggttggatcaggattcc
gtttcagaccagttcagtgtggaatttgaagtggagtcgctcgattcggaagattacagc
ctcagcgaggaggggcaggagccctcggatgacgatgacgaggtatatcgagtgactgtg
tatcaggcagaggagagcgatacagattcatttgaagaagatcctgaaatctccttagct
gactactggaagtgcacttcctgcggcgagacgaaccccccgctgccgtcacactgcagc
aggtgctgggcccttcgtgagagctggcttcctgaaggcaaagcaaaggcccctgggagc
gggagcgggatcgtggccccggaaggctccggccccggggaggagggcgttgatgtcccc
gactgcaggaagaccgaggggggccatcccagggaagcgtgcactgaggatgacgacgct
gctgccgcccaggcatcccagtcccaggagagtgagggctgctcccagccgccagcttcc
accagcggggctcacagcagccaggaaggccccggcgagctggagagggaagacgcaccc
gacaaggaggaaagcgtggaggccagcctgcccctcaacgccactgagccgtgtgtgatt
tgccaaggtcgaccaaagaatgggtgcatcgtccacggcaaaacagggcacctcatggcg
tgcttcacgtgcgcgaagaagctgaagaggaggaacaagccgtgccccgtgtgcaggcag
cccattcagatgatcgtgctgacctacttcccctag

DBGET integrated database retrieval system