KEGG   Equus caballus (horse): 100052296
Entry
100052296         CDS       T01058                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb04140  Autophagy - animal
ecb04144  Endocytosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100052296 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100052296 (TRAF6)
   04064 NF-kappa B signaling pathway
    100052296 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100052296 (TRAF6)
   04140 Autophagy - animal
    100052296 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100052296 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100052296 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100052296 (TRAF6)
   04657 IL-17 signaling pathway
    100052296 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100052296 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100052296 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100052296 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100052296 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100052296 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100052296 (TRAF6)
   05135 Yersinia infection
    100052296 (TRAF6)
   05133 Pertussis
    100052296 (TRAF6)
   05152 Tuberculosis
    100052296 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100052296 (TRAF6)
   05161 Hepatitis B
    100052296 (TRAF6)
   05160 Hepatitis C
    100052296 (TRAF6)
   05171 Coronavirus disease - COVID-19
    100052296 (TRAF6)
   05162 Measles
    100052296 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100052296 (TRAF6)
   05169 Epstein-Barr virus infection
    100052296 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100052296 (TRAF6)
   05140 Leishmaniasis
    100052296 (TRAF6)
   05142 Chagas disease
    100052296 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100052296 (TRAF6)
   04121 Ubiquitin system [BR:ecb04121]
    100052296 (TRAF6)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100052296 (TRAF6)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100052296 (TRAF6)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100052296 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 zf-TRAF_2 Tropomyosin_1 SlyX U-box Spc29 EzrA DUF4455 UPF0242 DUF16 DUF3450 Sina DUF1664 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 100052296
NCBI-ProteinID: XP_023509660
LinkDB
Position
12
AA seq 541 aa
MSLLNCENSCGSSQTESDCCAAMASSCSAAAKDDSVSGTASTGNLSSSFMEDIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNGGCLHKMELRHLEDHQAHCEFALMNCPQCQHPFQKCQLNIHMLK
ECPRRQVSCVNCAVSMAFEDKEIHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFNTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALAPVPQRDMLPYDSAPL
SRVSSGCYPEVRNFQETIQQLEGRLVRQDHQIRELTAKMETQSIYVSELKRTIRTLEDKV
AEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDTG
V
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaatagctgtggatccagccagactgaaagtgactgctgt
gcagccatggccagctcctgtagtgctgcggcaaaagacgacagcgtgagtggaactgcc
agcacggggaatctctccagctctttcatggaagatatccagggatatgatgtggagttt
gacccacccctggagagcaagtatgaatgtcccatctgcttgatggcgctgcgggaagca
gtgcaaacaccgtgcggccataggttctgcaaagcctgcatcatcaagtcaataagggat
gcaggtcacaaatgtccagtcgacaatgaaatactgctggaaaatcaactatttcctgac
aattttgcaaaacgagagattctttctctgatggtgaaatgtccaaatggaggttgtttg
cacaagatggaactgaggcatcttgaggatcatcaagcacattgtgaatttgctcttatg
aattgtccccagtgccagcatcccttccaaaaatgccaacttaatattcacatgctcaag
gagtgtccaaggagacaggtttcttgtgtaaactgtgctgtatcgatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatattgcaatacc
atgctcatcagagaacagatgcctaatcattatgatctagactgtcctacagccccaatt
ccatgcacgttcaatacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctgcaagagaacacccagtcgcacatgagaatgttggcccaggctgtccagagttta
agccttgccctagctcccgtacctcagcgggacatgctcccatatgattctgcccctctg
tcccgggtgtcctctgggtgttacccagaggtccggaatttccaagaaaccattcagcag
ttagagggtcgccttgtaagacaagaccatcaaatccgggagctgacagcgaaaatggaa
actcagagcatatatgtaagtgagctcaaacgaactattcgaacccttgaggacaaagtt
gctgaaatagaagcacagcaatgcaatggcatttatatctggaagattggcaactttggg
atgcacttaaaatctcaagaagaggagaagcctgttgtcattcatagccctggattctac
acaggcaaacctggatacaaactgtgcatgcgcctgcacctccagttacccaccgctcag
cgctgtgcaaactatatatccctctttgtccacacgatgcaaggagagtatgacagccac
ctcccttggcccttccagggtacaatacgccttacgattcttgatcagtccgaagcaccc
ataaggcaaaaccatgaagagataatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaacccaaaaggttttggctatgtgactttcatgcatctggaagct
ctaagacaaagaaccttcattaaggatgatactttgttagtacgctgtgaagtctctacc
cgctttgacatgggcagccttcggagggagggttttcagccacgaagcactgatactggg
gtatag

KEGG   Equus caballus (horse): 100055110
Entry
100055110         CDS       T01058                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04064  NF-kappa B signaling pathway
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04668  TNF signaling pathway
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100055110 (TRAF3)
   04668 TNF signaling pathway
    100055110 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100055110 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100055110 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100055110 (TRAF3)
   04657 IL-17 signaling pathway
    100055110 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055110 (TRAF3)
   05203 Viral carcinogenesis
    100055110 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100055110 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100055110 (TRAF3)
   05160 Hepatitis C
    100055110 (TRAF3)
   05171 Coronavirus disease - COVID-19
    100055110 (TRAF3)
   05164 Influenza A
    100055110 (TRAF3)
   05162 Measles
    100055110 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100055110 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100055110 (TRAF3)
   05169 Epstein-Barr virus infection
    100055110 (TRAF3)
   05165 Human papillomavirus infection
    100055110 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 zf-C3HC4_2 Crescentin MPS2 Spc7 Spc29 Cast Tropomyosin_1 KxDL T3SSipB BLOC1_2 FliJ DUF1664 GAS DUF3450 SPATA24
Other DBs
NCBI-GeneID: 100055110
NCBI-ProteinID: NP_001288147
Ensembl: ENSECAG00000013973
VGNC: 24456
UniProt: A0A3Q2I5E6
LinkDB
Position
24
AA seq 568 aa
MESSKKMDSPGALQTNPPLKLHPDRSTSTAVFVPEQGGYKERFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCETCMAALLSSSSPKCTACQEGIIKDKVFKDNCCKREILALQIYCRNE
SRGCVEQLTLGHLLVHLKNDCQFEELACVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCI
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtcgagtaagaagatggactcccctggcgccctgcagactaacccgccgctaaag
ctgcaccctgaccgcagcaccagcacggcagttttcgtccctgaacaaggaggttacaaa
gaaaggtttgtgaagacagtggaggacaagtacaagtgcgagaagtgccgcctggtgctg
tgtaacccaaagcagactgagtgtggacaccgcttctgcgagacctgcatggctgccctg
ctgagctcctcaagcccaaaatgtactgcgtgtcaagaaggcatcattaaagataaggtg
tttaaggataattgctgcaagagagagattctggctcttcagatatattgtaggaatgaa
agtagaggttgtgtagagcagttaaccctgggacatctgctggtgcatttaaagaacgat
tgccagtttgaagaacttgcgtgcgttcgtcctgactgcaaagagaaagtattgagaaaa
gacctgcgtgatcacgtggaaaaggcctgtaaatatcgcgaggccacatgcagtcactgc
aagagtcaggttccaatgattacgttgcagaaacacgaagacactgagtgtccctgtgtg
gtggtgtcctgccctcataagtgcagtgtgcagacccttctgagaagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcatt
tttcaggggacaaaccagcagattaaggcccacgaggccagctccgcggtgcagcatgtc
aacttactgaaagagtggagcaattccctagagaaaaaggtttccttgctgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatacttcatttacag
cgagtaatagacagccaagcagagaaactgaaagagctcgacaaagagatccgtcccttc
aggcagaactgggaagaagctgacagcatgaaaagcagcgtggagtccctccagaaccgc
gtgacagagctggaaagtgtggacaaaagtgcagggcaggcagctcggaacacaggcttg
ctggagtcccagctgagccggcacgaccagatgctgagtgttcacgacatccgcctggct
gacatggacctgcgatttcaggtcctggagaccgccagctacaatggcgtgctgatttgg
aagatccgagattataagcggcggaagcaggaagctgtcatggggaagaccctgtccctt
tacagccagcctttctacaccggctattttggctataagatgtgtgccagagtctacctg
aacggggacgggatggggaaggggacgcatttgtcgctgttttttgtcattatgcgtgga
gaatatgatgcactgcttccttggccgttcaagcaaaaagtgaccctcatgctgatggat
cagggctcctctcgccgtcacttgggagacgcgttcaagccagaccccaacagcagcagc
ttcaagaaacccaccggggagatgaatattgcctctggctgcccagtctttgtggcccaa
actgtgctagaaaatgggacatatattaaagatgataccatttttattaaagtcatagtg
gatacttcggatctgcctgacccctga

KEGG   Equus caballus (horse): 100055119
Entry
100055119         CDS       T01058                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb04064  NF-kappa B signaling pathway
ecb04217  Necroptosis
ecb04621  NOD-like receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04668  TNF signaling pathway
ecb05163  Human cytomegalovirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100055119 (TRAF5)
   04668 TNF signaling pathway
    100055119 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100055119 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100055119 (TRAF5)
   04657 IL-17 signaling pathway
    100055119 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055119 (TRAF5)
   05203 Viral carcinogenesis
    100055119 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100055119 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100055119 (TRAF5)
   05168 Herpes simplex virus 1 infection
    100055119 (TRAF5)
   05163 Human cytomegalovirus infection
    100055119 (TRAF5)
   05169 Epstein-Barr virus infection
    100055119 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100055119 (TRAF5)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100055119 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-TRAF_2 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 MATH zf-RING_2 zf-RING_UBOX DUF4941 zf-RING_6 zf-ACC LRRFIP Sina BLOC1_2
Other DBs
NCBI-GeneID: 100055119
NCBI-ProteinID: XP_023496527
Ensembl: ENSECAG00000007165
VGNC: 24461
LinkDB
Position
5
AA seq 558 aa
MAYSEEQGGVPCGFIRQNSSNSVSLDFEPNTEYRFVEQLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNAVPLCPVDKEVIKSQEVFKDNCCKREVLNLYVYCKNAPGCNAKI
ILGRYQDHLQQCLFQAVQCSNEHCQESVLRKNLKEHLSAYCQFREEKCLYCKKDVVVINL
QNHEENMCPEYPVSCPNKCLQIIPRTEVDEHLAVCPEAEQDCPFKQYGCPVKDKRGNLQE
HEHSALRDHMLLVLEKNLQLEKQISDLHRSLERKESKIQQLTETVNKFEKEFKQFAQLFG
KNGSFLSNIQLLASHLDKSAWLEAQVRQLLQMANQQETKFDLRALMEAIDTVKQKITLLE
THDQRIVVLEGETNKHDVHINIHKAQLNKNEERFKLLEGACYNGKLIWKVTDYKMKKREA
LEGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNHIMETFKADPNSSSFKRPDGEMNIASGCPRFVAHSTLENAKNTYIK
DDTIFLKVAVDLTDLEDL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggcttattctgaggagcaaggaggtgtcccctgtggtttcatccgtcagaattccagc
aactccgtttccttggactttgagcccaacacagagtatcggttcgtagagcagttagaa
gagcgctacaaatgtgccttctgccactctgtgcttcacaacccccaccagacgggctgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaatgcagtcccactc
tgccctgtagataaggaggttatcaaatctcaggaggtgtttaaagacaattgctgcaaa
agggaagtcctcaatttgtatgtatattgcaaaaatgctcctggatgtaatgccaagatt
attctgggacgataccaggaccaccttcagcagtgcctatttcaagctgtgcagtgttct
aacgagcactgtcaggaatcagtccttcggaaaaatctgaaagagcatttgagtgcatac
tgccagtttcgagaggaaaaatgcctttattgcaaaaaggacgtggtagtaatcaatcta
cagaatcacgaggaaaacatgtgtcccgagtacccagtatcttgtcccaacaagtgtttg
cagattattccaagaactgaggtggatgagcaccttgctgtgtgtcctgaagctgaacaa
gactgcccttttaagcagtatggctgtcctgtcaaggataagcgggggaaccttcaggag
catgagcattcagccttacgggaccacatgctcctggttttagaaaagaatctccaatta
gaaaaacagatttctgacttacataggagcctagaacggaaagaaagtaaaattcagcag
ctaacggaaacggtaaataaattcgaaaaggagttcaagcagtttgcacagctgtttggc
aaaaatggaagcttcctctcaaacatccagcttcttgcgagtcaccttgacaagtccgct
tggctagaagctcaagtgcgccagttactacaaatggctaaccagcaagaaactaaattt
gacctgagggctttgatggaagcaattgacacagtgaaacagaaaattaccctgctagaa
acccatgatcaaagaatagttgttttggaaggagagactaacaaacatgatgtccacatt
aatattcataaagcacagctgaataaaaatgaagaacgatttaaactgctagaaggtgcc
tgctataatggaaagctcatctggaaggtgacagactacaagatgaaaaagagggaggcg
ctggaagggcacacggtatccatcttcagccagcctttctacaccagccggtgtggctac
cggctctgtgctagagcatacctgaatggggacgggtctgggaaggggacgcacctgtcg
ctgtactttgtggtgatgcgaggggagtttgactcactgttgcagtggccattcaggcag
agggtgaccctgatgcttttggaccagagtggcaaaaagaaccatattatggagaccttc
aaggctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcctct
ggctgtccccgctttgtggctcattccactttggagaatgccaagaatacctacattaaa
gatgacaccatcttcctgaaagtggctgtggatttaactgacctggaggatctctag

KEGG   Equus caballus (horse): 100067681
Entry
100067681         CDS       T01058                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1 isoform X2
  KO
K03172  TNF receptor-associated factor 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04064  NF-kappa B signaling pathway
ecb04210  Apoptosis
ecb04668  TNF signaling pathway
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100067681 (TRAF1)
   04668 TNF signaling pathway
    100067681 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100067681 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067681 (TRAF1)
   05202 Transcriptional misregulation in cancer
    100067681 (TRAF1)
   05203 Viral carcinogenesis
    100067681 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100067681 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 100067681
NCBI-ProteinID: XP_014591497
Ensembl: ENSECAG00000011454
VGNC: 24454
UniProt: F6ZLL5
LinkDB
Position
25
AA seq 415 aa
MASGSASSPRPAPDENEFPFGCPPTVCEDPSEPRALCCAACLSENSRNGEDRVCLKCRGD
DSQSVGPGSLVSQEKDLPEVAEAGVGCPFAGVGCSFKGSPKFMQEHEVASQATHLNLVLG
FMKQWKAQLGSGLGSGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHF
MKEKLLAELEGKLRVFENIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVLELQQ
TLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKY
GYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLIDQNNREHAIDA
FRPDLNSASFQRPQSETNVASGCPLFFPLSRLQSPKHAYVKDDTMFLKCIVETSA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcctctggctcagccagcagcccccgcccggcccccgatgagaacgagtttcccttt
gggtgcccccccaccgtctgcgaggacccatcagagcccagggccctctgctgtgctgcc
tgtctctctgagaactcgaggaacggcgaggatcgggtctgtctcaaatgcagaggggac
gactcccagtctgtgggcccaggaagcctggtgtctcaggagaaggacctcccggaggtg
gctgaggctggagttgggtgcccctttgcaggtgtcggctgctccttcaaggggagccca
aagttcatgcaggagcatgaggtcgcctcccaggccacccacctaaacctggtgttgggc
ttcatgaaacagtggaaggcccagctgggctctggcctggggtccgggcccatggccctg
gagcagaatctgtcagacctgcagctgcaggcggccgtggaggtggctggagacctggag
gtcgactgttaccgggcaccctgttccgagagccaggaggagctggccctgcagcacttc
atgaaggagaagctcctggccgagctggaggggaagctgcgtgtgtttgagaacatcgtc
gctgtcctcaacaaggaggtggaggcctcccacctggccctggccgcctccatccaccag
agccagctggaccgtgagcacatcctgagcctggaacagcgggtgctggagttgcagcag
accctggcccagaaagaccaggccctgggcaagctggagcagagcctccgcctcatggag
gaggcctcctttgacggtaccttcctgtggaagatcaccaatgtcaccaggcggtgccat
gagtcggcctgcggcaggactgtcagcctcttctccccagctttctacactgccaagtac
ggctacaaactgtgcctgcggctctatctgaatggggacgggacggggaagaggacccac
ctctcgctcttcatcgtgatcatgagaggggagtatgacgctctgctgccgtggcctttc
cggaacaaggtcaccttcatgctcattgaccagaataaccgggagcacgccatcgatgcc
ttccggcccgacctgaactcagcatccttccagcggccccagagtgaaaccaacgtggcc
agcggctgcccgctcttcttccccctcagcaggctgcagtcgcccaagcacgcctacgtg
aaggacgacaccatgttcctcaagtgcatcgtggagacaagtgcttag

KEGG   Equus caballus (horse): 100068006
Entry
100068006         CDS       T01058                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04141  Protein processing in endoplasmic reticulum
ecb04210  Apoptosis
ecb04217  Necroptosis
ecb04380  Osteoclast differentiation
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04668  TNF signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04932  Non-alcoholic fatty liver disease
ecb05010  Alzheimer disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05160  Hepatitis C
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100068006 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100068006 (TRAF2)
   04064 NF-kappa B signaling pathway
    100068006 (TRAF2)
   04668 TNF signaling pathway
    100068006 (TRAF2)
   04071 Sphingolipid signaling pathway
    100068006 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100068006 (TRAF2)
   04217 Necroptosis
    100068006 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100068006 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    100068006 (TRAF2)
   04657 IL-17 signaling pathway
    100068006 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100068006 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100068006 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100068006 (TRAF2)
   05203 Viral carcinogenesis
    100068006 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100068006 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100068006 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    100068006 (TRAF2)
   05016 Huntington disease
    100068006 (TRAF2)
   05017 Spinocerebellar ataxia
    100068006 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    100068006 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100068006 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100068006 (TRAF2)
   05135 Yersinia infection
    100068006 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100068006 (TRAF2)
   05160 Hepatitis C
    100068006 (TRAF2)
   05168 Herpes simplex virus 1 infection
    100068006 (TRAF2)
   05163 Human cytomegalovirus infection
    100068006 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100068006 (TRAF2)
   05169 Epstein-Barr virus infection
    100068006 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ecb03019]
    100068006 (TRAF2)
   04121 Ubiquitin system [BR:ecb04121]
    100068006 (TRAF2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100068006 (TRAF2)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100068006 (TRAF2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100068006 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH SlyX
Other DBs
NCBI-GeneID: 100068006
NCBI-ProteinID: XP_023485172
Ensembl: ENSECAG00000013192
VGNC: 24455
LinkDB
Position
25
AA seq 516 aa
MAAASVTPPGSLDLLQPGFSKTLLGTKLEDKYLCSACKNVLRRPFQAQCGHRYCSYCLTS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGHCPFMLTECPACKGLVRLGEKEHHLEHECPERSLSCRHCRAPCCWADMKAHHD
VCPKFPLTCDGCGKKKISREKFQDHVRTCGKCRVPCRFHAVGCPEMVESEKQQEHEAKWL
QEHLAMLLGVLLDTKHLLGDSSSFLGQSQVGNPGAEVSKAAELLQRCEALERKTATFENI
VCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVHEM
EASTFDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGT
HVSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNI
ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggctgcagctagtgtgactcctcctggctccctagatttgctgcagcccggcttctca
aagacccttctggggaccaagctggaggacaagtacctgtgctcggcctgcaagaacgtc
ctgcgcagacccttccaggcacagtgtggccaccgctactgctcctactgcctgaccagc
atcttgagctccgggccccagaactgtgctgcctgcgtgcatgagggcatatatgaagaa
ggcatttcgattttagaaagcagttcggctttcccggacaacgccgcccgcagggaggtg
gagagcctgccggctgtctgtcccagcgacggctgcacctggaaggggacccttaaagag
tacgagagctgccatgaaggacactgcccgttcatgctgaccgagtgccctgcatgtaaa
ggcctggtgcgccttggcgagaaggagcaccacttggagcacgagtgcccggagagaagc
ctcagctgcaggcactgccgggcgccctgctgctgggccgacatgaaggcgcaccatgat
gtctgccccaagttccccttgacttgtgacggctgcggcaagaagaagatctcacgcgag
aagtttcaggaccacgtcagaacgtgtggcaaatgccgagtcccctgcaggttccacgct
gtcggctgccctgagatggtggagagcgagaagcagcaggagcacgaggcaaagtggctc
caggagcacctggccatgctgctgggtgtcctcctggatacaaagcacctcttgggagat
agcagcagtttccttggccagagccaggtggggaacccaggggcggaggtctccaaggct
gcagagctcctgcagaggtgtgaggccttggagaggaagacggctacctttgagaacatt
gtctgcgtcctgaaccgggaggtggagagggtggctatgaccgccgaggcctgtggccgg
cagcaccggctggaccaagacaggatcgaagccctgagtaacaaggtgcagcaattggag
aggagcattggtctgaaggacctggcgatggccgacttggagcagaaggtccacgagatg
gaggcgtccaccttcgatggtgtattcatctggaagatctctgacttcaccaggaagcgc
caggaagccgtggctggccgcacgcccgccatcttctccccagccttctacacgagcagg
tacggctacaagatgtgtctgcgcatctacctgaacggagatggcactgggcgtgggaca
catgtgtctctcttctttgtggtgatgaagggccccaacgacgccctcctgcggtggccc
ttcaaccaaaaggtgaccttaatgctgcttgaccagaacaatcgggagcatgtgatcgat
gccttcaggcccgacgtgacctcctcctctttccagaggcctgtcagtgacatgaacatt
gcaagcggctgccctctcttctgccctgtctctaagatggaggccaagaattcctatgtg
cgcgatgacgccatcttcatcaaggccatcgtggacctgacggggctctag

KEGG   Equus caballus (horse): 100072085
Entry
100072085         CDS       T01058                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4 isoform X1
  KO
K09848  TNF receptor-associated factor 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04657  IL-17 signaling pathway
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100072085 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100072085 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100072085 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-RING_5 zf-RING_2 zf-RING_6 zf-TRAF_2 zf-C3HC4_3 zf-rbx1 zf_Hakai
Other DBs
NCBI-GeneID: 100072085
NCBI-ProteinID: XP_023508881
Ensembl: ENSECAG00000011568
VGNC: 24460
LinkDB
Position
11
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPTK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAFESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCAKEFVFDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPGHLK
DSCSTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggcttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccgctg
tgcgggaagcccatgcgcgagcccgtgcaggtttctacctgcggccaccgcttctgcgac
acctgcctgcaggagttcctcagtgaaggagtcttcaaatgccctgaggaccaacttcct
ctggactatgccaagatctacccagacccagagctggaggtgcaggtactgggcctgcct
attcgctgcatccacagtgaggagggctgccgctggagcgggccacttcgtcacctacag
ggccacctgaatacctgcagcttcaatgtagtcccctgccccaatcgctgccccaccaag
ctgagccgccgggatctgcctgcacacttgcagcacgactgccccaagcggcgcctcaag
tgcgagttttgtggctgtgacttcagtggggaggcctttgagagccacgagggcatgtgc
ccccaagagagtgtctactgtgagaacaagtgtggtgcccgcatgatgcggcggctgctg
gcccagcatgccacctctgagtgccccaagcgcacccagccttgcacctactgcgccaag
gagttcgtctttgacaccatccagagccaccagtaccagtgtccgaggctgcctgtgccc
tgccccaaccagtgtggtgtgggcactgtggctcgggaggacctgccgggccatctgaag
gacagctgtagcactgccctggtgctatgtccattcaaagactctggctgcaagcacagg
tgccctaagctggcaatggcacggcacgtggaggagagcgtgaaaccacatctggccatg
atgtgtgcccttgtgagccggcagcggcaggagctgcaggagctgcggcgagagctggag
gagctatcggtgggcagtgatggtgtgctcatctggaagattggcagctatgggcgacgg
ctgcaggaggccaaagccaagcccaacctcgagtgcttcagcccggccttttacacacat
aagtatggctacaagctgcaggtgtctgcatttctcaatggcaacggcagtggtgagggt
acacacctctccctctacattcgcgtgctgccaggtgcctttgacaatctccttgagtgg
ccctttgcccgccgtgtaaccttctccctgctggatcagagcgaccccgggctggctaag
ccacagcatgtcactgagacctttcaccccgacccaaactggaagaatttccaaaaacca
ggcacttggaggggctccctggatgagagttctctgggctttggttaccccaagttcatc
tcccaccaggatatccgcaagcgaaactatgtgcgggatgatgcagtcttcatccgtgcc
tctgttgaattgccccgaaagatcctcagctga

DBGET integrated database retrieval system