KEGG   Equus caballus (horse): 100052552
Entry
100052552         CDS       T01058                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04115  p53 signaling pathway
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05134  Legionellosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05164  Influenza A
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100052552 (APAF1)
   04215 Apoptosis - multiple species
    100052552 (APAF1)
   04115 p53 signaling pathway
    100052552 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100052552 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100052552 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100052552 (APAF1)
   05012 Parkinson disease
    100052552 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100052552 (APAF1)
   05016 Huntington disease
    100052552 (APAF1)
   05020 Prion disease
    100052552 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100052552 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100052552 (APAF1)
   05152 Tuberculosis
    100052552 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100052552 (APAF1)
   05160 Hepatitis C
    100052552 (APAF1)
   05164 Influenza A
    100052552 (APAF1)
   05162 Measles
    100052552 (APAF1)
   05168 Herpes simplex virus 1 infection
    100052552 (APAF1)
   05169 Epstein-Barr virus infection
    100052552 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100052552 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Utp8 AAA_16 NACHT AAA_22
Other DBs
NCBI-GeneID: 100052552
NCBI-ProteinID: NP_001296086
Ensembl: ENSECAG00000024703
VGNC: 15395
UniProt: F6R504
LinkDB
Position
28
AA seq 1256 aa
MDAKARNCLLQHREALEKDIKTSYIMDYMISDGVLTVSEEEKVKNEPTRQQKAAMLIKMI
LKKDNYCYISFYKALLQEGYKDLAALLHGGIPVLSSSNGKDSLVGVTSYVKTVLCEGGVP
QRPVVFVTRKKLVHAIRQKLLKLDGEPGWVTIYGMAGCGKSVLAAEAVRDHTLLEGCFPG
GVHWLSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDRSVTDSVMGPKYVIPVESGLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKCSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNRSQLQDLHRKIITQFQRHHRLHTLSPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKEISV
CSQDCSVCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGML
YLEWINKKNIKNLSRLVVRPHTDAVYHACFSGDGQRIASCGADKTLQVFKAETGEKLLEI
KAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNNSHH
LLLATGSSDSFLKLWDLNEKDCRNTMFGHTNSVNHCRFSPDDKLLASCSADGSLKLWDVK
SANERKSINVKQFFISSEEPQEDMEVIVKCCSWSSDGARIMVAAKNKIFLVDVHTCGLLA
EIHTGHHSTIQYCDFSPSNHLAVVALSQYCVELWNMDSCLKVADCRGHLSWVHSVMFSPD
GSSFLTSSDDETIRLWETKKVCKNSGIVLKQEIDVLFQENEVMILAVDNMRRLQLINGKT
GQIDYLTEAQVSSCCLSPHLQYVALGGEDGAIKILELLNNRIFQSKIGHKSAVRHVQFTT
DGKTLISSSDDSVIQVWNWQSEEYVFLQAHQEAVKDFRLLRNSRLLSWSFDGTVKVWNII
TGRIEKDFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCS
VFSGDSTLLATGDDNGEIRIWSVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKML
VSAEGSLKWWNAVTGESAQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQVLE
NT seq 3771 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttacttcaacatagagaagccctggaaaaggacatc
aaaacctcctacatcatggattacatgattagtgatggagttttaacagtatcggaggag
gaaaaagtaaaaaatgagcccactcgacagcaaaaagcagctatgttaattaaaatgata
cttaaaaaggataattattgctacatatcattctacaaggctctcctacaagaaggatat
aaagatcttgctgcccttctccatggtggcattcctgttctctcttcttccaatggcaaa
gattcgcttgttggagtaacttcatatgtaaagacagtcctgtgtgaaggtggagtacca
cagaggccagttgtttttgttactagaaagaagctggttcatgcaattcggcagaaactc
ctcaaattggatggtgaaccgggatgggtcaccatttatggaatggcaggttgtgggaag
tctgtattagctgcagaagctgttcgagatcataccctcttagaaggttgtttcccaggg
ggtgtgcattggctttcagttgggaaacaagacaaatctggacttctgatgaaactgcag
aatctttgcacacggttggatcaagatgagagtttctcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgctgcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggatccttgggtattaaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagacaggagtgttacagattcagtaatgggtcctaaatatgtaatc
cctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcacagtattataaaagagtgtaaaggttct
cctcttgtagtgtctttaattggtgcacttttacgtgattttcccaaccgctgggagtac
tacctcaggcagcttcagaataagcaatttaagaggataaggaaatgttcatcttatgat
tatgaagctctggatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttccatccttcaaaaggatgttaaggtgcctacaaaggtatta
tgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgttaat
aagtctctcttattctgtgatcgaaatggaaaatcatttcgttattatttacatgatctt
caagtagatttccttacagagaagaatcgcagccagcttcaggatctgcacaggaagata
atcactcagttccagagacaccacaggctacatactctttcaccagatcaggaggactgc
atgtattggtacaattttctggcctatcacatggccagtgccaatatgcacaaagaactt
tgtgctttaatgttttccttggattggattaaagcaaaaacggaacttgtaggtcctgct
catctgattcatgaatttgtggaatataggcatatattggatgaaaaggagatttcagtt
tgttcacaggattgttcagtctgtgagaatttccaggagtttttatctttaaatggacat
cttcttggacgacagccatttcctaatattgtacaactgggtctctgtgaaccggaaact
tcagaagtttatcagcaagctaagctgcaggccaagcaggaggtcgataacggaatgctt
tacctggagtggataaacaaaaaaaacatcaagaatctctcccgcttagttgtccgcccc
catacagatgctgtttaccatgcttgcttttctggggatggtcaaagaatagcttcttgt
ggtgctgataaaaccttgcaggtgttcaaagctgaaaccggagagaaacttttagaaatc
aaggctcatgaggatgaagtgctttgctgtgcattctctacagatgacagatttatagca
acctgctcagtggataaaaaagtgaagatttggaattctatgactggggaactagtacat
acctatgatgagcactcagagcaagtcaattgctgccacttcaccaacaacagtcatcac
cttctgttagccactgggtcaagtgactccttcctcaaactctgggatttgaatgaaaaa
gattgtcgaaataccatgtttggtcatacaaattcagtcaatcactgcagattttcacca
gatgataaacttttggctagttgttcagctgatggatcattgaagctttgggatgtgaaa
tcagcaaacgagaggaaaagcattaatgtgaagcagttctttataagttcagaggagcct
caagaggatatggaagtgatagtgaaatgttgttcatggtcttctgatggtgctagaata
atggtggcagcgaaaaataaaatcttccttgttgacgttcatacctgtggcctattggca
gaaatccatacaggtcaccacagcacgatccagtactgtgacttctccccaagtaaccat
ttggcggtggtagctttgtcccagtactgtgtggagttgtggaatatggactcgtgttta
aaagtagctgattgcagaggacatttaagttgggttcattctgtgatgttttctcctgat
ggatcatcatttttgacatcttctgatgatgagacaattaggctctgggagacaaagaaa
gtatgtaaaaactctggtatagtgttaaagcaagaaatagacgttctgtttcaagaaaat
gaagttatgattctcgcagttgacaacatgagacgtctgcaactcattaatggaaaaaca
ggtcagattgattatctgactgaagctcaagttagttcctgttgcttaagtccacatctt
cagtacgttgcacttggaggagaagatggagccattaagattttagaactcctaaacaac
agaatcttccaatccaagattgggcacaagagcgctgtacggcacgtccagttcacaact
gatgggaagactcttatttcaagctctgatgattctgtaattcaggtatggaattggcaa
tcagaggaatatgtctttctgcaagcccatcaggaagcagtgaaagactttaggctcttg
agaaattcaagactgctttcttggtcttttgatggaacagtgaaggtgtggaatattatt
actggaagaatagaaaaagacttcgtctgtcaccaggatacagtactttcttgtgatatt
tctcctgatgctaccaagttttcatctacctctgctgacaagactgcaaagatttggagt
tttgaactcctttcccctcttcatgaattgaggggccataaaggctgtgtgcgctgctct
gtcttctctggggacagtacactgttggcgactggagatgacaacggagaaatcaggata
tggagtgtctcaaacggtgagcttcttcatttgtgtgctccgatttcagtagaagaagga
gctgctacccacggaggctgggtgactgacctttgcttttctccagatagcaaaatgctt
gtctctgctgaaggatctcttaagtggtggaatgctgtcactggagaatccgcacagacc
ttctacacaaatggaaccaatcttaagaaaatacatgtgtcccctgacttcaaaacatat
gtgactgttgataatcttggtattttatatattttacaggttttagagtaa

DBGET integrated database retrieval system