KEGG   Equus caballus (horse): 100052790
Entry
100052790         CDS       T01058                                 

Gene name
FLCN
Definition
(RefSeq) folliculin
  KO
K09594  folliculin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04150  mTOR signaling pathway
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100052790 (FLCN)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100052790 (FLCN)
SSDB
Motif
Pfam: Folliculin_C Folliculin
Other DBs
NCBI-GeneID: 100052790
NCBI-ProteinID: XP_001489930
Ensembl: ENSECAG00000021007
LinkDB
Position
11
AA seq 578 aa
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGAGTGDSPGQGEQAEEEEGGIQMSSRIRA
HSPAEGASTESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPNHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIIAIMMDRI
YLINSWPFLLGKIRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWD
NSEAEEEKTPVLPEGAEGRELTKRPTDSSLLSDCGNWQPRKLSVFRSLRHMRQVLGAPSF
RMLAWHVLMGNQVIWKSRDADLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLS
PQVQIPSHVLSSEFAVIVEVHTATRSSLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPT
ILNKMEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGA
SEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPSASEPRN
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgaatgccatcgtcgctctctgtcacttctgcgagctccacggcccccgcactctgttt
tgcacagaagtcctgcatgccccacttccacaaggcgctgggactggggacagccccggc
cagggcgagcaggctgaggaggaggaaggcggcattcagatgagcagtcggatccgtgcc
cacagccccgcagaaggggccagcactgagtccagcagcccgggacccaaaaagtcagac
atgtgcgagggctgccggtcacttgctgcagggcatcctgggtatatcagccacgataag
gagacctcgattaaatatgtcagtcaccagcaccccaaccacccccagctcttcagcatt
gtccgccaggcctgtgtgcggagcctgagctgtgaggtctgccctggccgcgaaggcccc
atcttctttggggatgagcagcatgggttcgtgttcagccacactttcttcatcaaagac
agcttggccaggggcttccagcgctggtacagcatcatcgccatcatgatggaccgcatc
taccttatcaactcctggcccttcctgcttgggaagatccgaggaatcatcgatgaactc
cagggcaaggcactcaaggtgtttgaagcggagcagtttgggtgcccacagcgtgcccag
aggatgaacacggcttttacgccattcctgcaccaaaggaatggtaacgccgcccgttca
ctgacgtccttgacaagcgatgacaacttgtgggcatgccttcacacctcctttgcttgg
ctcctgaaggcgtgcggcagccggctgactgagaagctcctggagggcgcgcccaccgag
gacaccttggtccagatggagaagcttgcggacttagaagaggaatcagaaagttgggac
aactctgaggctgaagaggaaaaaacccctgtcttgccggagggtgcagaagggcgggag
ctgaccaagcgcccaacggattcttccctgctttcagactgcggaaactggcaaccgcga
aagctgtctgtctttaggtcccttcggcacatgaggcaggtcctgggtgccccatctttt
cgcatgttggcctggcacgttctcatggggaaccaggtgatctggaaaagtcgagatgca
gaccttgtccagtcagcgtttgaagttcttcggaccatgctgccggtgggctgtgtgcgc
atcatcccttacagcagccagtatgaggaggcctaccgctgcaacttcctggggctcagc
ccgcaggtgcagatcccctcccacgtgctgtcctcagaatttgctgtcatagtggaggtc
cacacagccacacgctccagcctccaccccgtcgggtgtgaggatgaccagtctctcagc
aagtatgagtttgtggtgaccagtggaagccctgtagctgcagaccgagtgggccccact
atcctgaacaagatggaagctgctttgaccaaccagaatctgtctgtggatgtggtcgac
cagtgcctcgtctgcctcaaggaagagtggatgaacaaagtgaaggtcctttttaaattc
accaaggtggacagtcgacccaaagaggacacacagaagctcctgagtatcctcggagca
tctgaggaggacaatgtcaagctgctcaagttctggatgacaggtctgagcaaaacctac
aagtcacacctcatgtccacagtccgaagcccctcagcctcagagcctcgtaattga

DBGET integrated database retrieval system