KEGG   Equus caballus (horse): 100052860Help
Entry
100052860         CDS       T01058                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00250  Alanine, aspartate and glutamate metabolism
ecb00410  beta-Alanine metabolism
ecb00430  Taurine and hypotaurine metabolism
ecb00650  Butanoate metabolism
ecb01100  Metabolic pathways
ecb04727  GABAergic synapse
ecb04940  Type I diabetes mellitus
Module
ecb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100052860 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100052860 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100052860 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100052860 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100052860 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100052860 (GAD1)
Enzymes [BR:ecb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100052860 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100052860
NCBI-ProteinID: XP_001498306
Ensembl: ENSECAG00000012405
VGNC: 18206
UniProt: F6ZIC0
LinkDB All DBs
Position
18
AA seq 594 aa AA seqDB search
MASSTPSSSATASNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLQAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERADSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaaccgcctcgaacgcgggagcagaccctaat
actactaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcttgtgaa
aacagtgacagagatggccgcttccggcgtacggagaccgacttctccaacctgtttgct
cgagatctgcttccagctaagaatggggaggagcaaactgtgcagttcttactggaggtg
gtggacatactcctcaactatgtccgcaagacattcgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccttggagcagatcctggtggactgcagagacaccctgaagtacggggtc
cgtacaggtcatcctcgatttttcaatcagctctccactggattggatatcattggttta
gccggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgttctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagctatatccaacatgtacagcatc
atggctgctcgatacaagtacttcccggaagttaagacaaagggcatggcggcagtgccc
aaactggtcctcttcacctcagaacatagtcactattccataaagaaagctggggctgca
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaaaataatt
ccagctgatttacaggcaaaaattcttgaagccaagcaaaagggatacgttcctctttat
gtcaatgcaactgctggcacaactgtttatggggcttttgatccgatacaggagattgca
gatatatgcgagaaatataacctctggctgcacgtcgatgctgcctggggcggtgggcta
ctcatgtccaggaagcaccgccataagctcagtggcatagaaagggccgactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctctgccatcctcgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
cagtatgatgtctcctacgacactggggacaaggcaattcagtgtggccgccatgtggac
attttcaagttctggctgatgtggaaagcaaaggggacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgctaagattaaaaacagagaagaattt
gagatggtttttgatggtgagcctgagcatacaaacgtctgtttctggtatattccacaa
agcctcaggggcgttccggatagccctgagcgacgggaaaaactccacagggtggctccc
aaaattaaagccctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctcaaacccagctgctacccagtctgatatc
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system