KEGG   Equus caballus (horse): 100053186Help
Entry
100053186         CDS       T01058                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ecb  Equus caballus (horse)
Pathway
ecb03030  DNA replication
ecb03410  Base excision repair
ecb03420  Nucleotide excision repair
ecb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100053186 (LIG1)
   03410 Base excision repair
    100053186 (LIG1)
   03420 Nucleotide excision repair
    100053186 (LIG1)
   03430 Mismatch repair
    100053186 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecb03032]
    100053186 (LIG1)
   03400 DNA repair and recombination proteins [BR:ecb03400]
    100053186 (LIG1)
Enzymes [BR:ecb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100053186 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100053186 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100053186 (LIG1)
DNA replication proteins [BR:ecb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100053186 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100053186 (LIG1)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100053186 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100053186 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100053186 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 100053186
NCBI-ProteinID: XP_023505780
Ensembl: ENSECAG00000015424
VGNC: 19663
LinkDB All DBs
Position
10
AA seq 912 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNGIRETEPPPKVALKERNGVVPEGDSPVKRPGRKA
ARVLGSEGEEEDEALTPPKDQKPAPDSPKVSPPSPESTPALCSASPARVSPSGIPKRRTA
RKQLPKRAIQDVLEDQSEDEDREAKRKKEEDEAETPTESLTEPEVAKRKEVEEKDRPMTP
PELPENSTEPPTDSVAEPEGAVKQEPQEDQPQPPPRAPKTLSSFFAPRKPAVKKEVKEEE
GSGAPRKEETKGPLDPPSYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLR
MVETLSNLLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGIGDGILLKAVAQATGRQLE
SVRAEAAEKGDVGLVAESSRSTQRLMLPPPALTASGVFTKFQDIARLAGSASTTKKMDVI
KGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVDAGKGK
TPEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCRLSPGVPLKPMLAHP
TRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDVISRIPK
IRLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYLNG
KSLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKDSCEGLMVKTL
DVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLACYDEES
EELQAICKLGTGFSDEELEEHHQSLQALVLPSPRPYVRADGAVAPDHWLDPSAVWEVKCA
DLSLSPIYPAARGMMDGEKGISLRFPRFIRVREDKKPEEATTSAQVAHLYWKQSQIQNQQ
GTDVDSDPEDFY
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggcaaagcaaagaagcca
gagaaggaagcgtccaacggcatcagagagacggaaccccctccaaaggtggcgctgaag
gagcggaatggagtggtgcccgagggcgactctccagtgaagaggccagggaggaaggca
gcccgggtcctgggcagcgaaggggaggaggaggacgaggccctcacgccccccaaagac
cagaagcctgccccggactctccgaaagtctcccctcccagtcctgagagcacccctgcc
ctctgcagcgcctctcctgcgcgcgtctccccgtcagggatcccgaagcgccgcacagct
cggaagcagcttcctaaacgggcgattcaggatgtcctggaagatcagagcgaggacgag
gacagggaagccaagaggaagaaggaggaagacgaagcagagaccccgacagaaagcctc
acagagcctgaagtggccaaaaggaaggaagtagaagagaaggaccggcccatgacgccc
ccagagctcccagagaactccacagagcccccgacggacagcgttgccgagcctgagggg
gccgtgaagcaggagccgcaggaggaccagcctcagcctcctcccagagcccccaagacg
ctcagcagcttcttcgccccccggaagcctgcagtcaaaaaagaagtgaaagaagaggag
gggtccggcgccccgagaaaggaggagaccaagggacccctggaccctcccagctacaat
cctgccaagaacaactaccatcccgtcgaagacgcctgctggaagccgggccagaaggtc
ccttatctggcggtggcccggacgtttgagaagatcgaggaggtttctgcgcggctccgg
atggtggagacgctgagcaacttgctgcgctccgtggtggccctgtcacccccagacctg
ctccccatcctctacctcagcctcaaccgccttgggccgccccagcagggcctggagctt
ggcatcggggacggcatccttctcaaggccgtggcccaggccacaggtcggcagctcgag
tctgtccgggctgaggccgccgagaagggcgacgtgggcctggtggccgagagcagccgc
agcacgcagaggctcatgcttcccccgcccgccctcaccgcctctggggtcttcaccaag
ttccaggacatcgcccggctcgctggcagcgcttccacaaccaagaagatggacgtcatc
aaaggcctctttgttgcctgccgccactcagaagcccggttcatcgccagggccctgagt
ggacggctgcgcctcgggctggcagagcagtcggtgttggccgccctggcccaggccgtg
agcctcacacccccgggccaagaattccccccggccgtggtggatgctgggaagggcaag
acaccagaggccagaaaaacatggctggaggagcaaggcatgatcctgaagcagacgttc
tgtgaggtgcccgacctggaccggatcgtccccgtgctgctggagcatggcctggaacgc
ctcccggagcactgcaggctgagcccaggggtccccctgaaaccaatgttggcacacccc
acccggggcgtcagtgaggtcctgaaacgcttcgaggaggcagccttcacctgcgagtac
aaatacgatgggcagagggctcagatccatgtcctggaaggcggggaggtgaaaatcttc
agcaggaatcaggaggacaataccggaaagtaccccgacgtcatcagccgcatccccaag
attagactcccgtcagtcacgtccttcatcctggacactgaagccgtggcctgggaccgg
gaaaagaagcagatccagccattccaagtgctcaccacccgcaagcgcaaggaggtggac
gccgcggagatacaggtgcaggtgtgtctgtacgccttcgacctcatctacctcaatgga
aagtccctggtgcgggagcccctttcccgacgccggcagctgcttcgggagaacttcgtg
gagacggagggcgagttcgtcttcgccacctccctggacaccaaggacacggaccagatc
gccgagttcctggagcagtcggtgaaagactcctgcgaggggctcatggtgaaaaccctg
gatgtcgacgccacctacgagatcgccaagaggtcgcacaactggctcaagctgaagaag
gactacctcgatggcgtgggcgacaccctggacctcgtggtgatcggcgcctacctgggc
cgggggaagcgggccggccgctacgggggcttcctgctggcctgctacgacgaggagagt
gaggagctgcaggccatatgcaagcttggtactggcttcagcgacgaggagctggaggag
catcaccagagcctgcaggccctggtgctgcccagcccgcgcccctacgtccgggcggac
ggcgccgtggcccccgaccactggctggaccccagcgccgtgtgggaggtgaagtgcgcc
gacctgtccctctcccccatctaccctgcggcccggggcatgatggatggcgagaagggg
atctcccttcgcttccctcggtttattcgcgtccgtgaagacaagaagcccgaggaggcc
accaccagcgcccaggtggcccatctgtactggaagcaaagtcagattcagaaccagcaa
ggcacggacgtggactccgacccggaagatttctactag

DBGET integrated database retrieval system