KEGG   Equus caballus (horse): 100053343
Entry
100053343         CDS       T01058                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04150  mTOR signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04530  Tight junction
ecb04611  Platelet activation
ecb04621  NOD-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04660  T cell receptor signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04921  Oxytocin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04972  Pancreatic secretion
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05135  Yersinia infection
ecb05152  Tuberculosis
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100053343 (RHOA)
   04015 Rap1 signaling pathway
    100053343 (RHOA)
   04310 Wnt signaling pathway
    100053343 (RHOA)
   04350 TGF-beta signaling pathway
    100053343 (RHOA)
   04072 Phospholipase D signaling pathway
    100053343 (RHOA)
   04071 Sphingolipid signaling pathway
    100053343 (RHOA)
   04024 cAMP signaling pathway
    100053343 (RHOA)
   04022 cGMP-PKG signaling pathway
    100053343 (RHOA)
   04150 mTOR signaling pathway
    100053343 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100053343 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100053343 (RHOA)
   04520 Adherens junction
    100053343 (RHOA)
   04530 Tight junction
    100053343 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100053343 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100053343 (RHOA)
   04621 NOD-like receptor signaling pathway
    100053343 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100053343 (RHOA)
   04660 T cell receptor signaling pathway
    100053343 (RHOA)
   04670 Leukocyte transendothelial migration
    100053343 (RHOA)
   04062 Chemokine signaling pathway
    100053343 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100053343 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100053343 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100053343 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100053343 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100053343 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    100053343 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100053343 (RHOA)
   05206 MicroRNAs in cancer
    100053343 (RHOA)
   05205 Proteoglycans in cancer
    100053343 (RHOA)
   05203 Viral carcinogenesis
    100053343 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100053343 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100053343 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100053343 (RHOA)
   05135 Yersinia infection
    100053343 (RHOA)
   05133 Pertussis
    100053343 (RHOA)
   05152 Tuberculosis
    100053343 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100053343 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100053343 (RHOA)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100053343 (RHOA)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100053343 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100053343 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100053343 (RHOA)
  Exosomal proteins of bladder cancer cells
   100053343 (RHOA)
GTP-binding proteins [BR:ecb04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100053343 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100053343
NCBI-ProteinID: NP_001295875
UniProt: K9K4D8
LinkDB
Position
16
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactcgtgattgttggtgatggagcctgtggcaagacttgc
ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacggtgtttgag
aactatgtggcagatatcgaagtggatgggaagcaggtagagttagctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcctctctcctacccagacaccgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
cctgaagtcaagcatttctgtcccaacgtgcccatcatcctggttggaaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa
ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctccaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system