KEGG   Equus caballus (horse): 100053438Help
Entry
100053438         CDS       T01058                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100053438 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100053438 (KMT5B)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100053438 (KMT5B)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100053438 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100053438
NCBI-ProteinID: XP_023510362
Ensembl: ENSECAG00000012952
VGNC: 19496
LinkDB All DBs
Position
12
AA seq 877 aa AA seqDB search
MKWLGEAKNMVVNGRRNGGKLSNDHQQTQPKVQHTGKDTVKAGRTAGERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKTQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSTRKSSIGVKKNSKGRGLTRPPASARST
SSTLTHASSSRAPKTLRKPAKPLPSKTKLRNHCKRLEQKSASRKLEMGNLVLKEPKVVLY
KNLPIKKDKEPEGPVQANVAGGCLTRHAAREHKQNSGRGAPSHGEGAPCTYTPRRSMRTR
TNLKETSDIKLEPNTLDGYKDSSTEPCPDSGEQPTPTVQEEELAHETAQNGEAKCHKTDN
SMSKKKSRQGKLVKQSAKPEESTPVHDSPGKAGVALDVMGSHSDQDEHSGPEGLPGSYTD
WAPSPGGGSVVTSDSFKAKDNFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRRHDSS
SKANDQESDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKRDEEG
RGSYVEGLHENGVCCSDPLSLLESQMEVGDYSQYEEESTDGPSSSEGDEEDDDDDDFEDD
FIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaagccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagactcaacccaaagtacagcacacgggaaaggacacggtg
aaggctggcagaaccgcgggcgagcggaggtcgagcagatgtaatggtaattcaggattt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagttttcct
cacaacaaccctgtgaggtttcggcctattaaaggaaggcaagaagaactgaaggaagta
attgaacgttttaagaaagatgagcacttggagaaagccttcaaatgtttgacctcaggc
gaatgggcacgtcactattttctcaacaagaacaaaacgcaggagaagctgttcaaggaa
catgtatttatttacttgcgaatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctgcttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgcggcgtttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatacggcatgtgtgaaggctctcagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatacggactcagagaaacagacaaacgcttaaatagg
cttaaaaagttaggggacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctacccgaaaatcttccattggt
gtgaagaagaacagcaagggcagaggactgacgaggccgccagcctctgcccgctctacc
tcgtccacgctaacccacgccagcagctccagggcaccaaagacgctgaggaagcccgca
aagcctttaccttcaaagacaaaactccgaaatcactgcaaacggctggagcaaaagagc
gcttcgagaaaactcgaaatgggaaacttggtacttaaagagcctaaagtagttctgtat
aaaaatttgcccattaaaaaagataaggagcccgagggaccagtccaggccaacgtggct
ggtgggtgcttaacgagacacgcagcaagagagcacaaacagaactctggccgaggtgct
ccttcgcatggggagggcgctccctgcacatacacccccaggcggtcgatgaggacgaga
acgaatctgaaggagacctctgatatcaagcttgaaccaaatacgttggacggctataag
gacagctcgacggagccttgccctgacagtggcgagcagccgactcctacagtgcaggaa
gaagaactggctcacgaaactgcacaaaatggggaagcaaagtgtcataagactgacaac
agcatgtcgaaaaagaaatcgcgacaaggaaaacttgtgaaacagtcggcaaaacccgag
gaatccactccggtgcatgattcccctggaaaagcgggtgtggcgctggatgtgatgggg
tcccactctgaccaggacgagcacagcggcccagagggcctgcctgggagctacacggac
tgggccccttcgcctgggggcggttcggttgtgacatcagatagcttcaaagcaaaagac
aacttcagaactgcaaaaagtaaaaagaagaggcgaatcacaaggtatgatgcacagtta
atcctggagaataactctgggattcccaaattgactcttcgcaggcgtcatgatagcagc
agcaaggcaaatgaccaagagagtgatggaatgaattcttcaaaaataagcatcaagttg
agtaaagaccatgaaaatgataataatctctatgtagcaaagcttaacaatggatttaac
tcaggatcgggcagtagttctacgaagctaaaaatccagctcaaacgggacgaggaaggt
agggggtcctatgtggaggggcttcatgaaaacggggtgtgctgtagtgaccccctttct
ctcctggagtctcagatggaagtcggcgactacagtcagtatgaggaggagagcaccgac
ggcccctcctcttcggagggcgacgaagaggacgacgacgacgacgactttgaagatgac
ttcattcctcttcctcccgccaagcgattgaggctgatagttgggaaggactccatagac
attgacatttcctccaggaggagagaggatcagtctctgaggcttaacgcgtaa

DBGET integrated database retrieval system