KEGG   Equus caballus (horse): 100053784
Entry
100053784         CDS       T01058                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X3
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb05200  Pathways in cancer
ecb05223  Non-small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100053784 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100053784 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100053784 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100053784 (EML4)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     100053784 (EML4)
SSDB
Motif
Pfam: WD40 HELP ANAPC4_WD40 SlyX Ribosomal_S7
Other DBs
NCBI-GeneID: 100053784
NCBI-ProteinID: XP_005600083
Ensembl: ENSECAG00000007410
VGNC: 17567
UniProt: F6T5V1
LinkDB
Position
15
AA seq 992 aa
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVPSKGPAVLREAISMSSITNGSGANRKPSHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEDSHSNDQSPQIRASPSPQPSSQPLQIHRQTQESKNSTPTKSIKRQPTAEK
AHNSWENSDDSRNKLLRAVSTSKLISKVIKNTDKHKDVIINQAKMSTREKNSQEGEYIKM
FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
SLSTLQVIGLGTFERGVGSLDFSKADSGIHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTN
EVVLAVEFHPTDANIIITCGKSHVLFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGD
VLTGDSGGVILIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGK
DRKVILWDHDLNPEREIEVPDQYGTIRAVAEGKGDQFLVGTSRNFILRGTFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYVVSENGR
KYSRYGKCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPSGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHSDSHLISTGGKDMSIIQWKLVEKLSLPQNEIAADTTLTKAPISSR
ESVMPSETPTLPPSQPLNETAEEESRISNSPTLLENSLEQTVEPSEDHSEEQSEGGSEDL
GEPVYEEPANAISEEQSEAAVTEDQQDPAPLS
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatatctgctgcaagtacttctgatgtc
caagatcgcctctcagctcttgagttacgagttcaacaacaagaagatgaaatcactgtg
ctaaaggcagctttggctgatgttttgaggcgtcttgcaatctctgaagatcatgtagcc
tcggtgaaaaaatcagtcccaagtaaaggccctgcagtccttcgagaagctatttccatg
tcctctataaccaatgggagtggtgcaaacagaaaaccaagccacaccagctctgtctca
attgcaagaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggattctcattctaatgatcaaagtccacaa
atacgagcatcaccttctccccagccctcttcacagcctctccaaatacacagacaaact
caagaaagcaagaattctactcccaccaaaagcataaaacgacaaccaacagctgaaaag
gcacataattcgtgggaaaattcagatgatagtcgtaataaattattgagggcagtttca
acatcaaaattaatatcaaaagttataaaaaatacagacaagcataaagatgtcatcatc
aaccaagcaaaaatgtcaacccgtgaaaaaaacagccaagaaggagaatatattaaaatg
tttatgcgaggtcggccaattacaatgttcattccttctgatgttgacaactatgatgac
atcagaacagaactgcctcctgagaagctcaaactggagtgggtatatggttatcgagga
aaggactgtcgagctaatgtttaccttcttcctaccggggaaatagtgtatttcatagca
tcagtagtagtactatttaattacgaggagagaactcaacgacactacctgggtcataca
gactgtgtgaaatgccttgctatacatcctgacaaaattaggattgcaactggacagata
gctggagtggataaagatggaaggcctctgcaaccccatgtcagagtgtgggattcagtt
agtctatccacactgcaagttattggacttggaacttttgagcgaggagtaggatccctg
gatttttcaaaagcagattcaggtattcatttatgtgttatcgatgactccaatgagcat
atgcttactgtatgggattggcagaaaaaatcaaaaggagcagaaataaagacaacaaat
gaagttgttttggctgtggagttccatccaacagatgcaaatatcataataacgtgtggt
aaatctcatgttttattctggacctggagtggcaattcactaacaagaaaacagggaatt
tttgggaaatatgaaaaaccaaaatttgtgcagtgtttagcattcttggggaatggagat
gttcttactggagactcaggtggagtcatacttatatggagcaaaactactgtagaaccc
acacctgggaaggggcctaaaggtgtttatcagatcagcaaacaaatcaaagctcatgat
ggcagtgtgttcacactttgtcagatgagaaatgggatgttattaactggaggagggaaa
gacagaaaagtaattctgtgggatcatgatctgaatcctgaaagagaaatagaggttcct
gatcagtatggaacaatcagagctgtagcagagggaaaaggagatcaatttttagtaggc
acatcacgaaattttattttacgaggaacatttaatgatggcttccaaatagaagtacag
ggtcatacagatgagctttggggtcttgccacacatcctttcaaagatttgctcctgaca
tgtgctcaggacagacaggtgtgcatgtggaactcagtggaacacaggctggaatggaca
aggcttgtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggcc
ataggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttct
atccacacagacgggaacgaacagctctctgtgatgcgctactcagtagatggcaccctc
ctggctgtaggatctcatgacaactttatttacctctatgtagtctcagaaaatggaaga
aaatatagcagatatggaaagtgcactggacattccagctatatcacacaccttgactgg
tccccagacaacaagtatataatgtctaactcgggagactatgagatattgtactgggac
attccaagtggctgcaaactaattaggaatcgatcggattgtaaggacatcgattggacg
acatacacctgtgtactaggctttcaagtctttggtgtctggccggaaggatccgatggg
acagatatcaatgctctggtgcgatcccacaacagaaaggtgatagctgttgctgatgac
ttttgcaaagtccatttgtttcagtatccctgctctaaagcaaaggctcccagtcacaag
tacagtgcccacagcagccatgtcaccaatgtgagttttactcacagtgacagtcacctg
atttcaactggtggaaaagacatgagcatcatccagtggaaacttgtggaaaagttatct
ttgcctcagaatgagattgcagcagatactactctaaccaaagcccccatctcttcccgt
gaaagtgtcatgccgtctgagactcccacactgcctccttcccagcccttaaatgagaca
gctgaagaagaaagtagaataagcaattctcccacgcttctggagaatagcctggaacag
actgtggagcccagtgaggaccacagcgaggagcagagtgaagggggcagcgaagacctt
ggtgagcctgtttatgaagagccagccaatgcgataagcgaggagcagagtgaagctgct
gttaccgaggaccagcaagatcctgcacccctatcctaa

KEGG   Equus caballus (horse): 100070891
Entry
100070891         CDS       T01058                                 

Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05200  Pathways in cancer
ecb05223  Non-small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070891
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100070891
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100070891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100070891
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100070891
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100070891
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   100070891
CD molecules [BR:ecb04090]
 Proteins
  100070891
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Gly_rich MAM FXa_inhibition
Other DBs
NCBI-GeneID: 100070891
NCBI-ProteinID: XP_023474203
LinkDB
Position
15
AA seq 1009 aa
MSWLIRGVLQGNVSLVLVENKTGKEQSRMVWHVATNEGLSLWQWTVLPLLDVADRFWLQI
VAWWGQGSRATVAFDNISISLDCYLTISGEDKMPQNTAPKSRNLFERNSNKESKPWENTP
GETPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSVVVGSEGPLKGIQTWKVPAT
DTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNRLIQ
KVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGA
KTDTFHPERLENNSSVLGLNGNSGAAVWFATGGNAASDNDPEMDGEDGVSFISPLGILYT
PALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKIICFCDHGTVLAEDGVSCIVSPTP
EPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTST
IMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQV
AVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKSF
LRETRPRPNQPSSLAMLDLLHVAQDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAK
IGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGY
MPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCT
QDPDVINTALPIEYGPLVEEEEKVPMRPKDPEGMPPLLVSPPQAKREEGQGPAAPLPLPS
TSSSKAMKKPTAAEISVRVTRAPAVEGGHVNMAFSQSNPPSELHKVQGSRNKPTSLWNPT
YGSWFTEKPAKKNNPPAKMEQQERGNLGREGSCTVPPNMAAGRLPGASLLLEPSSLTANM
KEVPLFRLRHFPCGNVNYGYQQQGLPLEATPAPGTSHYEDAILKTQPGP
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtcctggctcatccgtggagtcttgcagggaaacgtctccttggtgctggtggaaaac
aaaactgggaaggagcaaagcaggatggtctggcatgtggccaccaatgaaggcttgagc
ctgtggcagtggacggtgctacctctcctggatgtggccgacaggttctggctgcagatt
gtcgcttggtggggacaaggatccagagccaccgtggcttttgacaatatctccatcagc
ctggactgctacctcaccatcagtggggaggacaagatgccacagaatacagcacccaaa
tcaagaaatctgtttgaaagaaattcaaacaaggagtcgaaaccctgggaaaatacacca
ggagagacccccatctttgaccctacagttcactggctcttcaccacgtgcggggccagc
gggccccatggccccacgcaggcccagtgcaacaacgcctaccggaactccaacctgagc
gtggtggtggggagcgagggccccctgaagggcatccagacctggaaggtgccagccacc
gacacctacagcatctcgggctatggagctgctggcgggaaaggcgggaagaacaccatg
atgcggtcccacggcgtgtctgtgctgggcatcttcaacctggagaaggacgacatgctg
tacatcctggtcgggcaacagggggaagacgcctgccccagcacaaaccgattaatccag
aaagtctgcattggagagaacaacgtgatagaagaagaaatccgcgtgaacagaagcgtg
catgagtgggcaggaggcggcggaggaggaggcggagccacctacgtgtttaagatgaag
gatggcgtgcccgtgcccctgatcattgcagccggcggtggcggccgggcctacggggcc
aagacagacacattccacccagagagactggagaataactcctcggttctggggctcaac
ggcaattccggagccgcagtctggtttgccacaggcggcaacgcagcctcagacaatgac
cccgagatggacggagaggatggggtctccttcatcagtccactgggcatcctgtacacc
ccggctttaaaagtgatggagggccacggggaagtaaatattaagcattacctaaactgc
agccactgtgaggtagatgagtgccacatggaccccgagagccacaagatcatctgcttc
tgtgaccatgggacagtgctggcagaggatggcgtctcctgcatcgtctcacccaccccg
gagccccacctgccactctcgctgatcctctctgtcgtgacctctgccctcgtggccgcc
ctcgtcctggctttctctggcatcatgatcgtgtaccgccggaagcaccaggagctgcaa
gccatgcagatggagctgcagagtcccgagtacaagctgagcaagctccgcacttcaacc
atcatgaccgactacaaccccaactactgctttgctggcaagacctcctccatcagtgac
ctgaaggaggtgccgcggaaaaacatcaccctcattcggggtctgggccatggcgcattt
ggggaggtgtatgaaggccaggtgtctggaatgcccaacgacccaagccccctgcaagtg
gctgtaaagacgctgcctgaggtatgttccgaacaggatgaactggatttcctcatggaa
gccctgatcatcagcaaattcaaccaccagaacatcgtgcgctgtattggggtgagtctg
caagccttgccccggtttatcctgctggagctcatggcgggaggagacctcaagtccttc
ctccgggagacccgccctcgcccgaatcagccctcctccctggccatgctggaccttctg
catgtggctcaggacatcgcctgtggttgtcagtatctagaggaaaatcacttcatccac
cgggacattgctgccagaaactgcctcctgacctgtccaggccctggaagagtggccaag
attggggactttggaatggcccgagacatctacagagcaagctactaccgaaagggaggc
tgtgcaatgctgccagtcaaatggatgcccccagaggccttcatggaaggaatatttact
tctaaaacagacacgtggtccttcggagtgctgctgtgggaaatattttctctcggatat
atgccgtaccctagcaaaagcaaccaggaagttctggagttcgtcaccagcggaggacgg
atggacccacctaagaactgccctgggcctgtataccggataatgacccagtgctggcaa
caccagcctgaagacaggcccaactttgccataattttggagaggattgaatactgcacc
caggacccagatgtgatcaacacagctttgccaatagaatatggcccactcgtggaggag
gaagagaaagtgcctatgaggcccaaagaccccgagggaatgcctcctctgctagtctct
cctccccaagctaaacgtgaggaaggacagggtccagctgccccgctccctctgccttcc
acttcgtctagcaaagccatgaagaaaccaacagctgcagagatctctgttcgagtcact
agagcgccagccgtggaagggggacatgttaatatggcattctctcagtccaacccacca
tcagagctgcacaaagtccagggatccagaaacaaaccaaccagcctatggaatccaact
tatggctcatggtttacagagaaacccgccaaaaagaacaatcctccagcaaagatggag
caacaggagaggggaaacttgggacgtgagggaagctgtactgtcccccctaacatggca
gctggcagacttccaggcgcctctctgctcctagaaccatcttcgctgactgccaacatg
aaggaagttcccctgtttaggctgcgtcacttcccgtgtggaaatgtcaactatggctac
cagcaacagggcttacctttagaggccacccctgcccctggaactagtcattatgaggac
gccattctgaaaacccagcctgggccctga

DBGET integrated database retrieval system