KEGG   Equus caballus (horse): 100053882
Entry
100053882         CDS       T01058                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04934  Cushing syndrome
ecb05161  Hepatitis B
ecb05162  Measles
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05215  Prostate cancer
ecb05222  Small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100053882 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100053882 (CCNE1)
   04114 Oocyte meiosis
    100053882 (CCNE1)
   04115 p53 signaling pathway
    100053882 (CCNE1)
   04218 Cellular senescence
    100053882 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100053882 (CCNE1)
   05206 MicroRNAs in cancer
    100053882 (CCNE1)
   05203 Viral carcinogenesis
    100053882 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100053882 (CCNE1)
   05215 Prostate cancer
    100053882 (CCNE1)
   05222 Small cell lung cancer
    100053882 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100053882 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100053882 (CCNE1)
   05161 Hepatitis B
    100053882 (CCNE1)
   05162 Measles
    100053882 (CCNE1)
   05169 Epstein-Barr virus infection
    100053882 (CCNE1)
   05165 Human papillomavirus infection
    100053882 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecb03032]
    100053882 (CCNE1)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100053882 (CCNE1)
DNA replication proteins [BR:ecb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100053882 (CCNE1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100053882 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100053882
NCBI-ProteinID: XP_023505227
Ensembl: ENSECAG00000021289
VGNC: 16211
LinkDB
Position
10
AA seq 408 aa
MPRERRERDAQERDGMKEDSSADVSVRSRKRKANVAVFLQDPDEEIAKMDKTVRSQCGRQ
SWDSNAVCENPCSLIPTPDKEEDELVYPNCGPQSIAPSRASPLPVLNWANREEVWKIMLN
KEKTYLRDKHFLQRHPLLQPKMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQQN
VVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGAEILTMELIIMKALKWRLS
PLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQVFIQIAELLDLCVLDVGCLEFSYGVLAAS
ALYHFSSSELMQRVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNIQT
HLNSLDLLDKAQAKKAILSEQNRISPPPTGVLTPPQSSKKQSSGQGTV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgccgagggagaggagggagagggatgcccaggagcgggacggcatgaaggaggacagc
agcgcggatgtctctgttcgctccaggaaaagaaaggcaaatgtggccgtgtttttgcag
gatccggatgaagaaattgccaaaatggacaagaccgtgaggagccagtgcggccgtcag
tcgtgggacagtaacgcagtctgtgaaaacccctgctccttgattcccacaccggacaaa
gaagaggacgagctggtgtaccccaactgtgggcctcagagcatcgcaccgtctcgagcc
tcgccactgcctgtgctgaactgggcaaacagagaggaggtttggaaaatcatgttaaac
aaggaaaagacgtacttaagggataagcacttcctgcagcggcaccctcttctgcagcct
aaaatgcgagcagttcttctggactggttaatggaggtgtgtgaagtctataagcttcac
agagagacgttttacttggcacaggatttctttgatcgatatatggcaacacaacaaaat
gttgtaaaaacacttctacagcttattgggatttcatctttatttattgctgccaaactt
gaggaaatctatcctccaaagttgcaccagtttgcttatgttacggacggggcctgctca
ggagccgagattctcaccatggagctgatcattatgaaggcgctcaagtggcggctgagc
cccctgaccatcgtgtcctggctgaacgtgtacatgcaggtcgcatatctgaacgacttg
tacgaagtgctgctcccacagtacccccagcaggtcttcatacagatcgcagagctttta
gatctctgtgttctggatgtcggctgccttgagttctcctatggtgtgctcgctgcttct
gccttgtatcatttctcttcatctgaattgatgcaaagggtttctgggtaccagtggtgc
gacatagagaaatgtgtcaagtggatggtcccatttgccatggtgataagggagacggga
agttccaaactgaagcacttccggggcgtgcctgccgaagacgcacacaacatccagacc
cacctcaacagcttggatttgctggacaaagcccaagcaaagaaagccatattgtctgaa
caaaataggatttctcctccccccacgggggtcctcacccccccacagagcagtaagaag
cagagcagtgggcaggggacggtgtga

KEGG   Equus caballus (horse): 100055302
Entry
100055302         CDS       T01058                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04114  Oocyte meiosis
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04934  Cushing syndrome
ecb05161  Hepatitis B
ecb05162  Measles
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05215  Prostate cancer
ecb05222  Small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100055302 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100055302 (CCNE2)
   04114 Oocyte meiosis
    100055302 (CCNE2)
   04115 p53 signaling pathway
    100055302 (CCNE2)
   04218 Cellular senescence
    100055302 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055302 (CCNE2)
   05206 MicroRNAs in cancer
    100055302 (CCNE2)
   05203 Viral carcinogenesis
    100055302 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100055302 (CCNE2)
   05215 Prostate cancer
    100055302 (CCNE2)
   05222 Small cell lung cancer
    100055302 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100055302 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100055302 (CCNE2)
   05161 Hepatitis B
    100055302 (CCNE2)
   05162 Measles
    100055302 (CCNE2)
   05169 Epstein-Barr virus infection
    100055302 (CCNE2)
   05165 Human papillomavirus infection
    100055302 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecb03032]
    100055302 (CCNE2)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100055302 (CCNE2)
DNA replication proteins [BR:ecb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100055302 (CCNE2)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100055302 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100055302
NCBI-ProteinID: XP_023504476
Ensembl: ENSECAG00000020270
VGNC: 16212
LinkDB
Position
9
AA seq 404 aa
MSRRSSRLQAKQQPQPNQTDSPQEAQIIQAKKRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSTDVWLNMLKK
ETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDGHNIQTH
TNYLAMLDEVNYVNTFRKGGQVSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagcgaaacagcagccccagcccaaccagacggat
tccccgcaagaagcccagataattcaggccaagaagagaaaaacagcccaggatgtcaaa
aaaaggaaagaggaggtcaccaagaaacaccagtatgagattaggaattgctggccacct
gtattatctgggggtatcagtccttgcattatcattgaaacaccccacaaggaaatagga
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgacttaagctggggatgttcaacggatgtttggctaaacatgttaaaaaaa
gagaccagatacgttcatgataaacattttgaagttctgcattccgacctggagccccag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacgttttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaacatgcttcaactcattggaattacctcattattcattgcctccaaacttgag
gaaatctatgctcctaagctccaagagtttgcttatgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacaatcatctcctggctaaatctcttcctccaagtcgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactggctgctgctgcc
ttgtgccattttacctctatcgaagtggttaagaaagcctcaggtttggaatgggacaac
atttcagaatgtgtagactggatggtgccttttgtcagtgtagtaaaaagtacgagtcca
gtgaagctgaagatttttaagaagatttccatggaagacggacacaatatccagacccat
acaaattatctggctatgttggatgaagtaaattatgtaaacaccttcagaaagggggga
caggtgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaagcca
ccaggaaaacactaa

DBGET integrated database retrieval system