KEGG   Equus caballus (horse): 100053958
Entry
100053958         CDS       T01058                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04115  p53 signaling pathway
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04932  Non-alcoholic fatty liver disease
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05134  Legionellosis
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05222  Small cell lung cancer
ecb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100053958 (CYCS)
   04215 Apoptosis - multiple species
    100053958 (CYCS)
   04115 p53 signaling pathway
    100053958 (CYCS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100053958 (CYCS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100053958 (CYCS)
   05222 Small cell lung cancer
    100053958 (CYCS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100053958 (CYCS)
   05012 Parkinson disease
    100053958 (CYCS)
   05014 Amyotrophic lateral sclerosis
    100053958 (CYCS)
   05016 Huntington disease
    100053958 (CYCS)
   05017 Spinocerebellar ataxia
    100053958 (CYCS)
   05020 Prion disease
    100053958 (CYCS)
   05022 Pathways of neurodegeneration - multiple diseases
    100053958 (CYCS)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100053958 (CYCS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100053958 (CYCS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100053958 (CYCS)
   05134 Legionellosis
    100053958 (CYCS)
   05152 Tuberculosis
    100053958 (CYCS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100053958 (CYCS)
   05161 Hepatitis B
    100053958 (CYCS)
   05160 Hepatitis C
    100053958 (CYCS)
   05164 Influenza A
    100053958 (CYCS)
   05162 Measles
    100053958 (CYCS)
   05168 Herpes simplex virus 1 infection
    100053958 (CYCS)
   05163 Human cytomegalovirus infection
    100053958 (CYCS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100053958 (CYCS)
   05169 Epstein-Barr virus infection
    100053958 (CYCS)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100053958 (CYCS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100053958 (CYCS)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 100053958
NCBI-ProteinID: NP_001157486
Ensembl: ENSECAG00000014330
VGNC: 50468
UniProt: F7D4V9
LinkDB
Structure
PDB: 

Position
4
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatacc
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctatttgggcgaaag
acgggtcaggcccctggcttctcttacacagatgccaacaagaacaaaggcatcacctgg
aaagaggaaacactgatggaatatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgctggcattaagaagaagacagaaagagaagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Equus caballus (horse): 111768755
Entry
111768755         CDS       T01058                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04115  p53 signaling pathway
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04932  Non-alcoholic fatty liver disease
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05134  Legionellosis
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05222  Small cell lung cancer
ecb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111768755
   04215 Apoptosis - multiple species
    111768755
   04115 p53 signaling pathway
    111768755
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111768755
  09162 Cancer: specific types
   05210 Colorectal cancer
    111768755
   05222 Small cell lung cancer
    111768755
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111768755
   05012 Parkinson disease
    111768755
   05014 Amyotrophic lateral sclerosis
    111768755
   05016 Huntington disease
    111768755
   05017 Spinocerebellar ataxia
    111768755
   05020 Prion disease
    111768755
   05022 Pathways of neurodegeneration - multiple diseases
    111768755
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111768755
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111768755
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111768755
   05134 Legionellosis
    111768755
   05152 Tuberculosis
    111768755
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111768755
   05161 Hepatitis B
    111768755
   05160 Hepatitis C
    111768755
   05164 Influenza A
    111768755
   05162 Measles
    111768755
   05168 Herpes simplex virus 1 infection
    111768755
   05163 Human cytomegalovirus infection
    111768755
   05167 Kaposi sarcoma-associated herpesvirus infection
    111768755
   05169 Epstein-Barr virus infection
    111768755
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111768755
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111768755
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 111768755
NCBI-ProteinID: XP_023477827
LinkDB
Position
18
AA seq 105 aa
MGDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYSDANKNKGVIW
GEETLLEYLENPKKYIPGTKMIFAGLKKKSEREDLIQYLKRATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagatctttattcaaaaatgtgctcagtgccacaca
gtggaaaaaggtggaaaacacaagacaggtccaaatctctggggcctttttggccgaaaa
acaggacaagcaccaggattttcttactctgatgcaaacaaaaacaaaggtgttatctgg
ggagaggaaactctgttggaatatttggagaacccaaagaaatatatccctggaactaaa
atgatctttgctggtcttaaaaagaagagtgagagagaagatcttattcagtatttgaaa
cgggcaacatcttcataa

DBGET integrated database retrieval system