KEGG   Equus caballus (horse): 100054013Help
Entry
100054013         CDS       T01058                                 

Gene name
DCC
Definition
(RefSeq) netrin receptor DCC
  KO
K06765  deleted in colorectal carcinoma
Organism
ecb  Equus caballus (horse)
Pathway
ecb04360  Axon guidance
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100054013 (DCC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054013 (DCC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100054013 (DCC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Ig_4 Interfer-bind Ig_6 EphA2_TM Protocadherin V-set_CD47 FAM176 CD34_antigen Ly49 DUF4998 TMEM154
Motif
Other DBs
NCBI-GeneID: 100054013
NCBI-ProteinID: XP_023503591
Ensembl: ENSECAG00000021760
VGNC: 17036
LinkDB All DBs
Position
8
AA seq 1445 aa AA seqDB search
MENSLGCVWVPKLAFVLFGATLLSAHLQVTGFQIKAFTSLHFLSEPSDAITMRGGNVLLN
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLPNGSLSIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTARVAVAGPLRFLSQTESVTAFMGDTVLLKCEVFGEPMPTIHWQKNQQDL
TPNPGDSRVVVLPSGALQISRLQPGDIGIYRCLARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVIAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGTYTCVVTYKNENISASAELTVLVPPWFLIHPSNLYAYESMDIEFECAVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTS
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDV
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSANAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNAKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSVGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPAGTDPPGRDSPIQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSTLERSLAARRATRAKLMIPMDAQSNSPTVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGKTVSEGPTTQQPSMLPPTQPEHPS
SEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQSGPALPKTHVKTA
SLGLAGKARSPLLPVSVPTAPEVSEEGHKPTEDPANVYEQDDLSEQMASLEGLMKQLNAI
TGSAF
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtctcggatgtgtctgggtacccaagctggcttttgtactcttcggagct
accctgctcagcgcacatctacaagtcaccggtttccagattaaggctttcacatcactg
cacttcctatctgaaccttctgatgccatcacaatgcggggaggaaatgtcctcctgaac
tgctctgcagagtctgaccgaggcgtcccagttatcaagtggaagaaagatggcatccac
ctagccttgggaatggacgaaaggaagcagcaacttccaaatgggtctctctcgatacaa
aacatacttcactccaggcaccacaaaccagatgagggactttaccaatgtgaggcatct
ttaggagattctgggtcaattattagtcggacagcaagagtagcagtagcagggccactg
agattcctttcccagacagaatctgtcactgccttcatgggagacactgtgctactcaag
tgtgaagtctttggggagcctatgccgacaatacattggcagaaaaaccaacaagacctg
actccaaacccgggtgactcccgagtggtggtcttgccctctggagccttgcagatcagc
agacttcagccaggggacattggaatctatcgatgcttagcccggaatccagccagctca
agaacaggaaatgaagcagaagtcagaattttatcagatccaggactgcacaggcagctg
tattttctgcaaagaccatccaacgtaatagccattgaagggaaagatgctgtcctggag
tgctgtgtttctggctatcctcccccaagttttacctggttacgaggagaggaagtcatc
caactcaggtccaaaaagtattctttattgggtggaagcaacttgcttatctccaatgtg
acagatgatgacagtggaacttacacctgtgtggtcacatacaaaaatgagaatattagt
gcctccgcagagctcacagtcttggttccgccatggtttttaattcacccttccaacctc
tatgcctatgaaagcatggatattgagtttgaatgtgcagtctctggcaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaacttacgaatccttggagtggtgaagtcggatgaaggcttttatcaatgt
gtggctgaaaatgaggctggaaatgcccagaccagtgcacagctcattgtccctaaacct
gctatcccaagctccagtgtcctcccttctgctcccagagatgtggtccctgtcttggtt
tccagtcgattcgtccgtctcagctggcgcccacctgcagaagcaaaagggaacattcaa
accttcacagtctttttctccagagaaggtgacaacagggaacgagcactgaatacatca
cagcctgggtcccttcagcttactgtgggaaacctgaagccagaagccatgtacaccttc
cgagttgtggcctacaatgagtggggaccaggcgagagttctcaacccatcaaagtggcc
actcagcctgagttgcaagttccagggccagtagaaaacctgcaagccgtatctacctca
cctacctcaattcttattacctgggaaccccccgcctatgcaaatggtccagtccaaggt
tacagattgttctgcactgaggtgtccacgggaaaggaacagaatatagaagttgatgga
ctgtcttataagctggaaggcctgaaaaaattcacggaatatactcttcgattcctagct
tataatcgttatgggccaggagtgtctactgatgatataacagtggttacgctttctgat
gtgccaagtgccccgcctcagaacgtctccctggaagtagttaattcaaggagtatcaaa
gtaagctggctccctcctccatcaggaacacaaaatggatttattactggctataaaatt
cgacatagaaagacaacccgcaggggtgagatggaaaccctggagccgaataacctctgg
tacctgttcacaggactggagaaaggaagtcaatacagtttccaagtgtcagccatgaca
gtcaatggcactggaccaccttccaactggtacacagcggagaccccagagaatgatcta
gatgagtctcaagtccctgaccagccgagctctctccacgtgaggcctcagaccaactgc
atcatcatgagttggactcctcccttgaacccaaacattgtggtgcgaggctacattatt
ggttacggcgttgggagcccttatgccgagacagtgcgcgtggatagtaaacagcgatat
tattccattgagaggttagagtcaagttcccattatgtaatctccctaaaagcttttaac
aatgcaggagaaggagttcctctgtacgaaagtgccaccaccagatctataacagatccc
actgacccagttgattattatcctttgcttgatgatttccccacctcggtcccagatgtc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccatgatgccgtg
agggtcagctgggcagacaactctgtccctaagaaccaaaaaacgtccgaagtacgactt
tacacagtccggtggaggaccagcttttctgcgaacgcaaaatacaagtcagaagacaca
acatctctgagttacacagcaacaggcctcaaaccaaacaccatgtatgagttctcggtc
atggtaaccaaaaataggaggtcaagcacgtggagtatgactgcacatgccaccacatat
gaagcagccccaacctctgctcctaaggatttgacagtcattactcgagaagggaagcct
cgcgctgtcattgtgagctggcagcctcccttggaagccaatgggaaaattactgcttac
atcttgttttataccttggacaagaacataccaattgatgactggattatggaaacaatc
agtggtgatcggcttactcatcaaatcatggatctcaaccttgacactatgtattacttt
cgaattcaagcacgaaatgccaaaggagtggggcccctatctgatcccatcctcttcagg
actcttaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatggc
ggttattggccagttgatactaatttgattgatagaagcactctcaatgagccacccatt
ggccagatgcaccccccacatggcagcgtcactcctcagaagaacagcaacctgcttgtg
atcattgtggtcaccgttggtgtcatcacagtgctggtggtggtgatcgtggctgtgatt
tgcacccggcgctcttcagcccagcagagaaagaaacgggccactcacagtgttggcaaa
aggaagggcagccagaaggacctccggccccctgatctttggattcatcatgaagaaatg
gaaatgaaaaacattgagaagccagcaggcactgacccacctggaagggactcccccatc
cagagttgccaagacctcacaccagtcagtcacagccagtcagaaacccaactggggagc
aaaagcacctctcattcaggtcaagacactgaagaagcagggagctccatgtccactctg
gagaggtcactggctgcacgccgagctacccgtgccaagctcatgattcctatggacgcg
caatccaacagtcctactgttgtgagcgccatccctgtgccaaccctagaaagtgcccag
tacccaggaatccttccatctcccacgtgtggatacccccacccgcagttcaccctccgg
cctgtgccattcccaacactgtcagtggaccgaggtttcggagcaggaaaaacggtgagt
gaaggaccaaccacccaacagccgtccatgttgcccccaactcagcctgagcatcccagc
agtgaggaggcaccaagcagaaccatccccacggcctgtgttcgaccaacccatccactc
cgcagctttgccaaccctttgctacctccgccaatgagtgcaatagagccgaaagtccct
tatacaccgcttttgtctcagtcagggcctgctcttcccaagactcatgttaaaacagcc
tctcttgggttggctggaaaggcaagatctcctttgcttcctgtatctgtgccaacagcc
cctgaagtgtccgaggagggccacaaaccaacagaggatccagccaatgtgtacgaacag
gatgatctgagtgaacaaatggcaagtttggaagggctaatgaaacaacttaatgccatc
acaggctcggccttttaa

DBGET integrated database retrieval system