KEGG   Equus caballus (horse): 100054331
Entry
100054331         CDS       T01058                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04370  VEGF signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05134  Legionellosis
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05215  Prostate cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100054331 (CASP9)
   04151 PI3K-Akt signaling pathway
    100054331 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100054331 (CASP9)
   04215 Apoptosis - multiple species
    100054331 (CASP9)
   04115 p53 signaling pathway
    100054331 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100054331 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054331 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100054331 (CASP9)
   05212 Pancreatic cancer
    100054331 (CASP9)
   05215 Prostate cancer
    100054331 (CASP9)
   05213 Endometrial cancer
    100054331 (CASP9)
   05222 Small cell lung cancer
    100054331 (CASP9)
   05223 Non-small cell lung cancer
    100054331 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100054331 (CASP9)
   05012 Parkinson disease
    100054331 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100054331 (CASP9)
   05016 Huntington disease
    100054331 (CASP9)
   05020 Prion disease
    100054331 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100054331 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100054331 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100054331 (CASP9)
   05152 Tuberculosis
    100054331 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100054331 (CASP9)
   05161 Hepatitis B
    100054331 (CASP9)
   05160 Hepatitis C
    100054331 (CASP9)
   05164 Influenza A
    100054331 (CASP9)
   05162 Measles
    100054331 (CASP9)
   05168 Herpes simplex virus 1 infection
    100054331 (CASP9)
   05163 Human cytomegalovirus infection
    100054331 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100054331 (CASP9)
   05169 Epstein-Barr virus infection
    100054331 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100054331 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100054331 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100054331 (CASP9)
   01002 Peptidases and inhibitors [BR:ecb01002]
    100054331 (CASP9)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100054331 (CASP9)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100054331 (CASP9)
Peptidases and inhibitors [BR:ecb01002]
 Cysteine peptidases
  Family C14: caspase family
   100054331 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 100054331
NCBI-ProteinID: XP_005607561
Ensembl: ENSECAG00000017291
VGNC: 50673
LinkDB
Position
2
AA seq 451 aa
MNEADRQLLRRSRLRLVRELQVDSLWDALLTRELFTPDMIEDIQRSGSRRDQARQLIIDL
ETRGSQALLLFISCLEDTGQDTLASFLRTSSQAAKQNPEAIRPSDLPPVVLGPVGLKPEE
LTAVKQDPSKLTPGKLTPVVLGPEELWLAKLRPEVLRPEVPRPVDIGSGGFSDVRAQDRL
RGNADLAYVLNADPCGHCLIINNVNFYLASGLGRRVGSDIDCEKLRQRFSLLHFMVEVKG
DLTAKQMLRALGELARRDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSIESIVN
IFNGTGCPSLGGKPKLFFIQACGGEQKDPGCKVDSTSPEDRTPGSDSEPDAVPFQEGPGT
FDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDGVFEQWAHSEDLQTLLL
RVAHAVSEKGVYKQIPGCFNFLRKKFFFKTY
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgaacgaggccgaccggcagctcctgcggcggagccggctgaggctggtccgcgagctg
caggtggactcgctctgggacgctctgctaacccgcgagctcttcacgcccgacatgatc
gaggacatccagcgctctggatctcggcgcgatcaggccaggcagctgatcatagatcta
gagactcgagggagtcaagccctgcttttgttcatctcctgcttagaggacacaggccag
gacacactggcttcattcctgagaacgagtagccaagccgccaagcagaatccagaggcc
atcagaccctcggacctcccacctgtggtgctcggaccagtgggcctcaaaccagaggag
ctgacagcagtgaagcaggacccatcgaagctgactccaggaaaactcactccagtggtg
ctggggcccgaggagctctggctggccaagctcaggccagaggttctcagaccagaggtg
cccaggccagtggacattggttctggaggattcagtgatgtccgtgctcaggacagattg
aggggaaacgccgatttggcgtacgtcctgaacgcggacccctgtggccactgcctcatc
atcaacaacgtgaacttctacctggcgtcggggctcggcaggcgcgtcggctccgacatt
gactgcgagaagctgcggcagcgcttcagcctgctgcatttcatggtggaggtgaagggc
gacctgaccgccaagcaaatgctccgggccttgggggagctggcacggcgcgaccatggt
gctctagactgctgcgtggtggtcatcctctctcacggctgtcaggccagccacctccag
ttcccgggggctgtttatggcacagacggatgtcctgtgtccatcgagagcatcgtgaac
atcttcaatggaactggctgccccagcttgggagggaagcccaagctgtttttcatccag
gcctgcggtggggagcagaaagaccctgggtgtaaggtggactccacctcccctgaagac
aggacccctggcagtgactctgagccagatgctgtcccgttccaggaaggcccaggcacc
ttcgaccagccggatgctgtgtccagtttgcccacacccagtgacatctttgtgtcctac
tccaccttcccaggctttgtctcctggcgggatcccaagagcggctcctggtacgtcgag
accctggatggtgtgtttgagcagtgggctcactctgaagacctgcagaccctcctgctc
agggtagctcacgctgtttcggagaaaggagtttacaaacagattcctggttgttttaat
ttcctccggaaaaaatttttctttaaaacttactga

DBGET integrated database retrieval system